KEGG   Prochlorococcus sp. MIT 0604: EW14_1933Help
Entry
EW14_1933         CDS       T03304                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
prc  Prochlorococcus sp. MIT 0604
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EW14_1933
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EW14_1933
   00680 Methane metabolism
    EW14_1933
Enzymes [BR:prc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EW14_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1614104..1617040)
Genome map
AA seq 978 aa AA seqDB search
MDLISNNDPLDKNRLLIEDLWESVLREECPDDQAERLIQLKELSYSKQIDGNSSKTSKNE
IVEIVNSMDLSESIAAARAFSLYFQLVNILEQRVEEDRYIQSFTNKDVQKSPDNLDPFAP
ALARQNAPVTFRELFYRLRKLNVPPGKLEELLQEMDIRLVFTAHPTEIVRHTIRHKQTRV
ANLLKKIQIEQFLTKEEKNSLKTQLKEEVRLWWRTDELHQFKPSVLDEVDYALHYFQQVL
FNAMPQLRCRIAEALTENYPDVQMPSESFCNFGSWVGSDRDGNPSVTPDITWRTACYQRQ
LMLERYIIAISNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARATRYRSEPYRLK
LSYILEKLRLTQERNNLLADSGWKFDLEGEIDNKNLEKVENLYYQSVNEFTYDLELIKNS
LISTDLNCESVNTLLTQVHIFGFSLASLDIRQESTRHSEAIQELTNYLDLSVHYDQMSEE
EKIKWLIEELNTKRPLIPSDVNWTNTTEETFAVFKMVKRLQQEFGSRICHSYVISMSHSA
SDLLEVLLLAKEMGLFDQNSQKSKLLVVPLFETVEDLKRAPEVMEKLFKLDFYRSLLPKV
GESSKPLQELMLGYSDSNKDSGFVSSNWEIHRAQISLQNLSSRNNILLRLFHGRGGSVGR
GGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTTAVIQNSLVNNR
LDATPEWNQLMSRLAETSRSHYRRLVHENPDLLNFFQEVTPIEEISKLQISSRPARRKKG
AKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSSELNSDPKQIELLRVLHQRWPFFRML
ISKVEMTLSKVDLEVARYYVDTLGSKENKDSFDDIFEVISKEYILTKSLILEITGKNKLL
ESDRDLKSSVSLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFIIDQDESRRAYSRSELL
RGALLTINGIAAGMRNTG
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgattagtaacaatgatccacttgataaaaatcgtcttttaatagaagatcta
tgggaatctgtgctcagagaagaatgcccagatgatcaagcagagaggttgattcagctt
aaagaattaagttattcaaaacaaattgatggtaatagttcaaaaacttctaaaaatgaa
atagttgaaattgtaaattctatggatttatcagaatccatagcagcagcgagggcgttt
tcattatattttcaactcgtgaatattttggaacaaagagttgaagaagatagatatatt
caaagttttaccaataaggacgttcaaaaatcgcccgataatcttgatccttttgctcca
gcattggctagacaaaatgctccagtaacttttagagaattattttacaggctgaggaaa
ttaaatgtaccacctgggaaattagaagagttattgcaggaaatggatatccgtttagtt
tttactgcacatcccaccgagatagtgagacatacgattagacataagcaaacaagagta
gcaaatttattaaaaaaaatacagattgagcaatttctaacaaaagaagaaaaaaattct
ctaaaaacccaattaaaagaggaagtaagactttggtggagaacagatgaactgcatcaa
tttaaaccttcagttttagatgaagtagattatgctttgcattattttcagcaagtttta
tttaatgcgatgcctcaattgaggtgcaggatcgcagaagcacttactgaaaattatcca
gatgttcagatgccctctgaatctttttgtaacttcggttcttgggtaggctccgataga
gacggtaatccatcggttactcccgacataacatggagaactgcttgctaccaaaggcag
ttaatgttggaaagatatattattgcgatatctaatcttagagatcaattaagtgtttcg
atgcagtggagccaagtcagttcctctctattagagtcactcgaaacggatagggtcaag
ttcccagaaatctatgaagctagagctacaaggtatagatcagaaccttacagattgaaa
ttaagttatattttagagaaattaaggttaacacaggaaagaaataatttattagctgat
agtgggtggaaatttgacttggagggagaaattgacaataaaaatctagagaaagttgaa
aacttatattaccaatcagtaaacgaatttacttatgatctcgaattgattaaaaatagc
ctgattagtacagatttaaattgtgaatctgtaaacaccctacttactcaggttcacatt
tttggattttctttagcaagtttagatattcgtcaagagagtacaaggcatagtgaggct
atacaagagcttacaaattatcttgatctatcagtccattatgaccaaatgtctgaggaa
gagaaaattaaatggcttatagaggaattaaatacaaaaaggcctcttattccatctgac
gttaactggacaaacactacagaagaaacctttgcagtttttaaaatggttaagagatta
cagcaagaatttggaagtcgcatttgtcattcttatgtaatttcaatgagtcatagtgca
tctgacttgcttgaagttctcttactggcaaaagaaatgggactttttgatcaaaattcg
caaaagtcaaaattattagttgttcctctttttgaaactgtagaagaccttaaaagagca
ccagaagtaatggaaaagttgttcaaattagatttttatagatcattattaccaaaagtg
ggagaatcttctaaacctctgcaagaattaatgcttggatattctgatagcaataaagat
tcggggtttgtttctagtaattgggaaattcatagagcccaaatatctcttcaaaatctt
tcaagtagaaataatatattgctaagactttttcatggaagaggtggttctgtagggaga
ggaggaggaccagcctatcaggcaatattggctcaaccaagcggtactttaaaaggtcga
ataaaaataacagaacaaggcgaagttttagcctctaaatatagtcttcctgaactggct
ttatacaatcttgagactgtcactacagctgtaattcaaaatagtttggtaaataataga
cttgacgctactccagaatggaatcaattaatgtctaggctggcagaaacatcaaggtct
cactacagacgattagtgcatgagaatcctgatttgttaaatttctttcaagaggtcact
ccaatagaagaaataagtaaattacagatatctagtaggcctgctagaagaaaaaaaggt
gcaaaagatttatcaagtctaagagctattccatgggtgttcggttggacacaaagcaga
tttcttttgccaagttggtttggagtaggcactgcattgtcatctgaattaaattcagat
ccaaaacaaattgaattattaagagttctccatcaaagatggccattttttaggatgctt
atttctaaggtagaaatgacattatctaaggtagatttggaagttgctagatattatgtt
gatacccttggtagtaaagaaaataaagattcttttgatgatatttttgaagtcatttct
aaagaatatattcttacaaaatctttaatacttgaaattacgggtaaaaataagcttctc
gaatctgatagagacttgaaatcatcagtaagcttgagaaataaaacgataatcccattg
ggctttttacaggtttcacttttaagaagactaagagaccagacaaggcaaccaccaata
agcgaatttattattgatcaagatgaatctagaagagcttacagtagaagtgaactattg
aggggggcacttttaactattaatgggatagcagctggcatgagaaatacaggttaa

DBGET integrated database retrieval system