KEGG   Pseudomonas rhizosphaerae: LT40_20870Help
Entry
LT40_20870        CDS       T03339                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LT40_20870
  Energy metabolism
   00680 Methane metabolism
    LT40_20870
Enzymes [BR:prh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LT40_20870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4617452..4620097
Genome map
AA seq 881 aa AA seqDB search
MSDIDLRLREDVHLLGELLGNTIREQYGDAFLEKIERIRRGAKADRRRDPTGDAVSAELR
SSLDDLGEEELLPVARAFNQFLNLANICEQYQLIRRRDEGQPEPFENLALGELLGRLTAA
GHSPDALARQLVALDIELVLTAHPTEVARRTLIQKYDAIAAQLALHDHRDLTSAERNAVR
ERLQRLIAEAWHTEEIRRTRPTPVDEAKWGFAVIENSLWQAVPNHLRRVDAALQAATGQR
LPLGAAPIRFASWMGGDRDGNPNVTAKVTREVLLLARWMAADLFLRDVDQLAADLSMQQA
SAPLLAHAPDSSEPYRTVLKQLRERLRATRNWAHASLPGDQPADAQVLQDNRELIEPLQL
CFDSLHACGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSTRHRGALSEITEYLGLGRF
DDWDEAARIDFLVRELANRRPLLPTCFEPSEDTAEVLATCREVAAAPAASLGSYVISMAG
AASDVLAVQLLLKESGLRRSMRVVPLFETLADLDNAGPVLERLLQLPDYRGTLQGPQEIM
IGYSDSAKDAGTTAAAWAQYRAQETLVNICQAHGVELLLFHGRGGTVGRGGGPAHAAILS
QPPGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYVAAVLEATVLPPPLPEPAWRTVMD
ELAGQGVKAYRQVVREHPHFVEYFRQATPEQELGRLPLGSRPAKRRQGGIESLRAIPWIF
GWTQTRLMLPAWLGWEAALGAALARGEGDRLASMRAQWPFFRTRIDMLEMVLAKADAEIA
ALYDLRLVEPDLQPLGAQLRDLLSQCCTAVLGLTGQTHLLAHSPTTLEFFSLRNTYLDPL
HLLQAELLARSRAREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcgatctgcgcctgcgcgaagacgtgcacctgctcggtgagttgctgggc
aataccattcgcgagcagtacggcgatgcctttctggaaaagatcgagcgcattcgccgc
ggcgccaaggccgaccgtcgacgggatccgaccggtgatgcggtcagcgccgagctgagg
tccagtctggacgacctcggtgaggaagaactgctgcccgtggcccgagcgttcaaccaa
ttcctcaacctggccaatatctgcgagcagtaccaactgatccgccgtcgcgacgagggc
cagcctgaacccttcgaaaaccttgccctgggcgagttgctggggcggctgacggccgcc
gggcatagccccgacgcgttggcgcgacaactggtggcgctggatatcgagttggtgttg
accgcccaccctaccgaagtcgcgcgccgcaccctgatccagaaatacgacgcgatcgcc
gctcagctggccttgcacgaccatcgcgaccttaccagcgccgaacgcaatgccgtgcgt
gagcgcctgcagcgcctgatcgccgaggcctggcacaccgaagagatccgccgcacccgg
ccgacgccggtggacgaggccaaatggggcttcgcggtcatcgagaattcactgtggcag
gcggtgcccaaccatctgcgccgggtcgacgccgctttgcaggccgccaccgggcaacgc
ttgcccctgggcgccgcgccgatccgcttcgcttcgtggatgggcggcgaccgcgatggc
aacccgaatgtcacggccaaggtcacccgtgaagtgctgttgctggctcgctggatggca
gccgatctgtttctgcgcgatgtcgatcaactggccgccgatctgtcgatgcagcaggcc
agtgcgccgctcctggcccatgcacctgacagcagcgagccctaccgcacggtgctcaag
cagttacgcgagcgcctgcgggccacgcgcaactgggcccatgcgtcgctgccgggcgac
cagccggccgatgctcaggtgctgcaggacaatcgcgagctgatcgagccgctgcagctg
tgcttcgactcgctgcacgcctgtggcatgggcgtgatcgccgacggaccgctgctggac
tgcctgcgccgcgccgtgaccttcggcctgttcctggtgcgcctcgacgtgcgtcaggac
tcgacccgacatcgcggggcgctgagcgagatcaccgaatacctggggctgggtcgcttc
gatgactgggacgaggcagcacgaatcgactttctggtgcgtgagctggccaatcgccgg
ccgctgctgccgacctgtttcgagcccagtgaggacaccgccgaagtgctcgccacgtgc
cgcgaagtggcggcggcgccggctgcgtcgttgggctcctacgtgatctccatggccggc
gctgcctccgacgtgctggcagtgcagctgctgctcaaggagtccggcctgcgccgctcg
atgcgcgtggtgccgttgttcgaaaccctggccgacctcgataacgccggtcccgtgctg
gagcgcctgctgcaactgcccgactaccgcggcacgctgcaaggtccgcaggaaatcatg
atcggctattccgattcggccaaggatgccgggaccacggcagccgcgtgggcgcagtat
cgggcgcaggaaaccctggtgaacatctgccaggcgcacggcgtcgagctgttgctgttc
catggtcgcggcggcacggtgggccgtggtggcggcccggcccatgcggccatcctctcg
caaccgccaggttcggtagcgggccgcttccgcactaccgagcagggggaaatgattcgt
ttcaaattcggcctgccggatatcgccgagcagaacctgaacctgtatgtggcggccgtg
ctggaagccaccgtgctgccgccgccattgcccgagcccgcctggcgcacggtcatggac
gagctggcggggcagggcgtcaaggcgtaccggcaggtggtgcgtgagcatccgcacttc
gtcgagtactttcgccaggccacgccggaacaggagcttggccgactgccattgggcagt
cggccggccaagcgtcggcagggaggtatcgagagcctgcgagccatcccgtggatcttc
ggctggacccagacccggctgatgctgcccgcctggctgggatgggaagcagccctgggt
gcagcgctggcccgtggcgaaggggatcgactggcttcgatgcgcgcgcagtggccattt
ttccgcacgcgcatcgacatgctcgaaatggtactggccaaggccgacgccgagattgcg
gccttgtacgacctgcgtctggtcgagcctgacttgcaaccgctgggcgcgcagctgcgc
gacctattgtcgcagtgctgcacggccgtgctggggctgaccgggcagacacacctgctc
gcacacagcccgacgaccctggagttcttcagcctgcgcaatacgtatctggatccgttg
cacctgctgcaggccgaactgctggcacgctcgcgggcgcgcgaagcggcgctggacagc
cctctggaacaggcattgctggtcaccgtggccggtatagccgccgggctgcgcaatacc
ggttga

DBGET integrated database retrieval system