KEGG   Paenibacillus riograndensis: PRIO_6446Help
Entry
PRIO_6446         CDS       T03849                                 

Definition
(GenBank) Glucan 1,4-alpha-maltohexaosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pri  Paenibacillus riograndensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pri00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PRIO_6446
Enzymes [BR:pri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PRIO_6446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:7520215..7521750
Genome map
AA seq 511 aa AA seqDB search
MKRNHTMMQFFEWHVAADGQHWKRLAQMAPELKAAGIDSVWVPPVTKAISPEDTGYGVYD
LYDLGEFDQKGTIRTKYGTKQELIDAIAECLRNGIAVYVDLVMNHKAGADETEVFEVIEV
DPNNRNKEISAPFEIEGWTKFTFPGRGDTYSSFKWNHTHFNGTDFDAKGGRNGVFRINGE
NKNWNQNVDDEFGNYDYLMFANIDYSQQEVRREMLEWGKWLVDTLQCSGYRLDAIKHINH
EFIKEFAAEMTKKRGEDFYIVGEFWNSNLEACREFLNTVDYQIDLFDVSLHYKLYAAALG
GRDFDLTHIFDDTLVQTHPGNAVTFVDNHDSQPHEALESWVGDWFKQSAYALILLRRDGY
PVVFYGDYYGIGGPAPIEGKKAAIDPLLYARCHKAYGEQDDYFDHPNTIGWVRRGIEEIE
GSGCAVVISNGDNGEKRMFLGEERAGEVWVDFTHNRRESVTIGKDGWAVFPVNGGSVSVW
ALPDGAEVKPAAQDLDDVEKITKDSSGKRTH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaaccatactatgatgcaatttttcgaatggcatgtcgcggcagacggacag
cactggaagcggctggcccaaatggctcccgaactgaaagccgccggtattgattccgta
tgggtgcctccggtaacgaaagccatctctcccgaggatacaggctatggcgtgtatgat
ctctatgacctgggagaattcgaccaaaaagggacgatccgcacgaaatacggcaccaag
caggaattgatcgacgctattgccgaatgtctcaggaacggcattgccgtgtatgtggat
ctcgtcatgaatcataaagcgggcgcagacgagaccgaggtcttcgaggtgattgaggta
gacccgaacaaccgcaacaaggagatttccgcaccgttcgagatcgaaggctggaccaaa
ttcacgttccccggacggggggacacgtactccagcttcaaatggaaccatacgcatttc
aacggcaccgatttcgatgccaagggagggcgaaacggcgttttccggattaacggagag
aacaaaaactggaaccagaatgtggatgacgagttcggcaactatgattatctcatgttc
gcgaacattgactacagccagcaggaagtccggagagagatgctggaatggggcaagtgg
ctggtagatacgctgcagtgcagcggttaccggcttgacgccatcaaacatatcaatcat
gagtttatcaaagaattcgcggcggaaatgaccaaaaagcggggcgaagacttctacatc
gtcggagagttctggaattccaatctcgaagcctgccgggaattcctcaatacagtcgac
tatcagatagatctgttcgatgtatcgctgcattacaagctgtatgcggctgcgctgggc
ggcagagactttgacctgacgcatatttttgacgacacactggtgcagacccatcccggc
aatgccgtgaccttcgtggacaaccacgattcccagccgcacgaagcgttggagtcctgg
gtcggggactggttcaagcagagcgcctacgccctgatcctgctgcgccgtgacggatat
ccggtggtcttctacggtgattattacggcattggcgggcccgctcctatcgaaggcaaa
aaagcggccattgatcccttgctgtacgcccgctgccacaaggcctatggggagcaggat
gattatttcgatcatccgaacaccatcggctgggtccgccgcggcatagaagagattgag
ggctccggctgcgccgtggtgatctctaacggggataacggcgagaagcggatgttcctg
ggtgaggagcgggcgggagaggtctgggtggatttcacccataaccgcagggagtccgta
accatcggcaaggacggttgggcggtattccccgtgaacggcggaagcgtctctgtgtgg
gcgctgccggatggagcagaggtgaagcctgctgcgcaggatttggatgatgtagagaag
attacgaaggacagctccggtaaaaggacgcactga

DBGET integrated database retrieval system