KEGG   Prochlorococcus sp. MIT 0801: EW15_0646Help
Entry
EW15_0646         CDS       T03316                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
prm  Prochlorococcus sp. MIT 0801
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:prm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EW15_0646
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EW15_0646
Enzymes [BR:prm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     EW15_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
578502..579914
Genome map
AA seq 470 aa AA seqDB search
MAKKYDAGVKEYRDTYFTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLVDLEFYKGRCYRIEDVPGDKDAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKTCGGPPSGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTATTPE
EMYKRAEFAKELDMPIIMHDYITGGFTANTGLANWCRENGMLLHIHRAMHAVIDRHPQHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRTRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILLEAAKHSPELAIALETWKEIKFEFDTVDKLDVQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagtatgatgctggagttaaggagtatagagatacttacttcactcctgat
tacgtccccctagatactgatctacttgcatgttttaaatgcacaggtcaggaaggtgta
ccaaaggaagaggttgcagcagctgttgccgccgaatcatctacaggtacatggtcaaca
gtttggtcagaattacttgtagatcttgaattctacaaaggccgctgttaccgcattgaa
gatgtccctggagacaaggatgccttctatgcatttattgcctatccattagatcttttt
gaagagggatctataactaacgttttgacatcacttgtcggaaacgtctttggttttaaa
gccttgcgtcatcttcgacttgaagatattcgcttcccaatggcatttatcaagacttgc
ggcggaccaccaagtggaatcgtagtagaacgtgatcgtcttaataaatacggtcgtcca
ctacttggttgtactattaagccaaagcttggtctttcaggtaaaaactacggtcgtgtt
gtttacgaatgccttcgaggcggccttgacctaactaaagatgatgagaatatcaattct
cagccattccagcgttggagagagcgttttgaatttgttgctgaagctgtaaagctagct
caacaggaaactggtgaagttaaaggtcactacctgaattgcacagcaactacccctgaa
gagatgtataagcgtgctgagttcgctaaagaacttgacatgccaatcatcatgcatgac
tacatcactggtggttttactgctaatacaggtcttgctaattggtgccgtgaaaatggc
atgcttcttcatattcaccgtgctatgcatgcggttattgaccgtcatcctcagcatggt
attcacttcagagttcttgctaagtgtttgcgtctatccggcggagatcaacttcataca
ggaacagttgttggaaaattagaaggagaccgtcaaacaacgctaggctatatcgataat
cttcgtgaatcctttgtccccgaagaccgtactcgcggtaacttctttgatcaagattgg
ggttctatgcctggtgtatttgctgtggcatctggtggtattcatgtttggcatatgcca
gcattgcttgcaatctttggagatgattcatgtctccaatttggaggtggtactcatgga
cacccttggggatcagctgctggtgcagccgctaaccgagtagctctagaggcatgtgtg
aaagcgcgtaatgcaggtagagaaatcgaaaaagaaagtcgcgatatccttctagaagcc
gcaaagcatagccctgagttggcaattgctcttgagacatggaaggagattaagttcgaa
ttcgatacagtcgataaactcgacgttcagtag

DBGET integrated database retrieval system