KEGG   Pseudomonas stutzeri A1501: PST_2130Help
Entry
PST_2130          CDS       T00511                                 

Definition
(GenBank) DNA ligase, ATP-dependent, putative
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PST_2130
Enzymes [BR:psa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PST_2130
DNA repair and recombination proteins [BR:psa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PST_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2309026..2311581)
Genome map
AA seq 851 aa AA seqDB search
MALEDYQRMRDFAATPEPAGKARPKPRKSQALQYCIQKHDATRLHYDFRLELDGTLKSWA
IPKGPSLDPGVRRLAVHVEDHPLEYATFEGNIPEGHYGAGDVIVWDRGVWTPQGDPQEGY
RKGKLKFSLEGEKLAGSWNLVRTQMDGKKEQWFLIKSRDEAAREESEYDIVTAEPDSVLS
DRTLVPRKRGAKARVAETPPAPVKAPAKKRTPARRKAKVALEGAVPAELPERFKPQLATL
VDTVPVGDWRYEIKFDGYRMLARIDAGEVRLFTRNGHDWTAKMPQQAAALAGLGLESGWL
DGEVVVPNEEGTPDFQALQNAFEAGRSGSILYYLFDMPYLNGMDLREVALEQRRAALREV
LERSDSELLRFSEDFTEQPDSILESACQMKLEGLIGKRAGSTYTSRRSSSWVKIKCSNRQ
EFIIVGYTQPKGTRTGFGALLLGLHDDKGELRYAGKVGTGFNHATLQSLHKKLKKLETDK
SPLAKAPPAADARGAQWLKPELMCEVAYAEMTRQGVVRHSVFHGLRTDKPAEAITHERAK
PVARATPNVAGKADPLGSGRIKISNPERVIDPSSGITKIELARFYAQIAPWALPQLQNRP
LALVRAPEGITGELFFQKHADKLAIPHITQLDPALDPKHGALLVIDSAEALVGAAQMGTI
ELHSWNAVAPDLEHPDRFVLDLDPDPALPWKRMLEATQLTQTLLDEIGLASFLKTSGGKG
LHIVVPLDPVQDWSEVKSFSQAIARHLATLLPSHFSAVSGPKNRVGRIFIDYLRNSRGAS
TVAPYSVRAREGLPVSVPIHRDELADLKGANLWTVRNLLERLQELGDDDPWAAIGKTRQR
LTKKIRDRLNA
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgaagactaccaacgcatgcgtgacttcgccgctacgccggaacccgccggc
aaggcacggccgaagccccgcaagagccaggcgctgcagtactgcatccagaagcacgac
gccacgcgtctgcattacgacttccgcctggaactggacggcaccctgaagagctgggcg
attcccaaggggccaagcctggaccccggcgtgcgccggctggccgtacacgtggaagac
cacccgctggagtacgccaccttcgaagggaatatccccgaaggtcattatggtgccggc
gacgtgatcgtctgggatcgtggcgtgtggacgccccagggcgacccgcaggagggctat
cgcaagggcaagctcaagttcagcctggaaggcgagaagcttgccggcagctggaacctg
gtgcgcacgcagatggatgggaagaaggagcagtggttcctcatcaaatcccgtgacgag
gcggcgcgcgaggagagcgagtacgacatcgtcaccgccgagcccgacagcgtgctcagt
gaccgcaccctggtgccgcgcaagcgcggcgcgaaggcccgcgtggccgaaaccccgcct
gcgccagtcaaggcgcccgccaagaagcggacaccggccaggcgaaaggcaaaggtcgcg
ctcgagggggcggttccggccgagctaccggagcgtttcaaaccgcagctggccaccctg
gtcgatacggtaccggtcggggactggcggtacgaaatcaaattcgacggctaccggatg
ctcgcgcgcatcgacgccggcgaggtcaggctgtttacccgcaacggccacgactggacg
gcgaagatgccccagcaggccgcggcgcttgcgggactcgggctcgagtccgggtggctg
gatggcgaggtggtggtgccgaacgaggagggcacgccggacttccaggccttgcagaac
gctttcgaggcggggcgcagcggcagcattctctattacctgttcgacatgccttacctg
aacggcatggacctgcgcgaggtagcgctggagcagcgccgcgcagcgctgcgcgaggtg
ctggagcgcagtgacagcgagctgctgcgcttctccgaggactttaccgagcagccggac
agcattctggaaagcgcctgccagatgaaactcgaagggctgatcggcaagcgcgctggc
agcacctacacctcgcgacgcagtagcagctgggtgaagatcaaatgcagcaaccggcag
gaattcatcatcgtcggctatacccagcccaagggtacccgcaccggtttcggcgcgctg
ctgctcggcctgcacgacgacaagggcgagctgcgttacgccggcaaggtcggcaccggc
ttcaaccatgcaacgctgcaaagcctgcacaagaagctgaagaagctggaaaccgataaa
agcccgctggccaaggcaccgccagcagccgatgcacgtggcgcgcagtggctcaagccg
gaactgatgtgcgaagttgcctatgccgaaatgacccgtcagggtgtggtgcgccactcg
gtgttccatggcctgcgaaccgacaagccggccgaggccatcacccacgagcgggccaaa
ccagtcgccagggcaacgccgaacgtcgccggcaaggccgatcccctcggcagcggtcgg
atcaagatttccaaccccgaaagggtcatcgaccccagcagcggcatcaccaagatcgaa
ctggcccgcttctacgcgcagatcgccccttgggcgttgccgcaattgcagaaccggccg
ctggcgctggtccgcgcgcctgaaggcatcactggcgagctgttcttccagaagcacgcc
gacaagctggccatcccgcatatcacgcagctggacccggcgctcgatcccaagcacggc
gcgctgctggtgatcgacagcgccgaggccctggtcggcgccgcgcagatgggcactatc
gagctgcacagctggaacgccgtggcgcccgatctcgagcaccctgaccgcttcgtgctg
gacctcgacccggatccggccctgccgtggaagcgcatgctcgaggcgacccagctgacc
cagacgctgctggacgagatcggcctggcatcgtttctcaagaccagcggcggcaagggg
ctgcacatcgtcgtaccgctcgaccccgtgcaggactggagcgaggtgaaatccttcagc
caggcgattgccaggcacctggcaacactcctgccgtcccatttctccgcggtcagcggg
ccgaagaaccgggtcgggcgcatcttcatcgactacctgcgcaacagccgtggcgccagc
accgtcgcgccgtactcggtacgcgcccgcgagggtctgccggtttccgtacccatccac
cgcgacgagctggcggacctcaagggcgccaacctgtggacggtgcgcaacctgctggaa
cgcctgcaggaactcggtgacgacgacccctgggcggccatcggcaagacccgccagcgc
ctgaccaaaaagattcgcgaccgcctgaacgcctga

DBGET integrated database retrieval system