KEGG   Paenibacillus sabinae: PSAB_02790Help
Entry
PSAB_02790        CDS       T03064                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psab  Paenibacillus sabinae
Brite
Enzymes [BR:psab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSAB_02790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AHV95494
UniProt: X4ZUL0
LinkDB All DBs
Position
complement(606338..607492)
Genome map
AA seq 384 aa AA seqDB search
MQYVYGPPPAVHVLNEIAFWKNQEKENAALIKLAVPELEEPYVKLLDEWNAVFGATEHSA
RSLLEAALSPAAAGSVDPAEINRLAAVSVEQSREFIRHLQALKEQSPDLRAETAETFLPH
VIRETEYFLGVLGGLGHPVNHFGDLRDYAADLPPGPFAVGTAAQDPELASAHRDLPSVPI
GGHKLPPLPYPYNALEPYIDEKTMRIHHDIHHKSYVDGLNKAEKKLADARKSGDFDLVKH
WERELAFNGAGHYLHTIFWDEMSPQGGGRPTGALLAAIERDFGSFDAFKKQFSEAAEKVE
GGGWAILVWSPRSRRLEILTAEKHQNLSQWDVIPLLALDVWEHAYYLKHQNKRGDYIQDW
WKVVNWPYVSERYAAASKLAWKPY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgtatatgggccaccgccggcggtgcacgtattgaatgaaattgcattctgg
aaaaatcaggagaaggagaacgcagcactgatcaagctcgccgttcccgaactggaggag
ccttacgtcaagctgctggatgaatggaacgccgttttcggcgctacggagcatagcgcc
cggagcctgctggaggcggcgctttcgcctgcggcggccgggagcgtggatcccgccgag
attaacagactggcggcggtatccgtcgaacaatcccgcgaatttattcgccacctgcaa
gccttgaaagaacagagcccggacctaagggcagagacggcggagacctttctgcctcat
gttatccgcgagacggaatattttctcggcgtcctgggcgggctcggccatcccgtcaac
catttcggagacttacgggattatgccgccgatcttccgcccgggccatttgccgtcggc
acggctgcacaggacccggagcttgcttccgcccaccgcgacctgccgtccgtgccgatc
ggagggcataagctcccccctctgccgtatccttacaacgcccttgagccgtacatcgac
gagaagacgatgcggattcatcacgacatccatcataagagctatgtggacggcctgaac
aaggcggagaaaaagctggcggacgcccgaaagagcggagatttcgatctagtcaagcat
tgggagcgggagcttgccttcaacggggccggtcattatctgcatacgatattctgggac
gaaatgtctccgcagggcggagggcgtccgaccggagctttgcttgcggccatcgagcgg
gacttcggaagctttgacgccttcaagaagcagttcagcgaagccgccgagaaggttgaa
ggcgggggctgggccattctcgtctggagtccgcgcagccgcagactcgagattctgacg
gcggagaagcaccagaacctgtcccagtgggatgtcatcccgctgctcgccctcgatgtc
tgggagcatgcctactacctgaagcatcagaacaagcgcggcgattatattcaggactgg
tggaaagttgtaaactggccttatgtatccgaaagatatgccgcggcaagcaaactcgcc
tggaagccctactaa

DBGET integrated database retrieval system