KEGG   Paenibacillus sabinae: PSAB_04970Help
Entry
PSAB_04970        CDS       T03064                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psab  Paenibacillus sabinae
Pathway
psab03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psab00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PSAB_04970
Enzymes [BR:psab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PSAB_04970
DNA repair and recombination proteins [BR:psab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PSAB_04970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AHV95930
UniProt: X4ZGT4
LinkDB All DBs
Position
complement(1140637..1141581)
Genome map
AA seq 314 aa AA seqDB search
MKLTPIVPFEPVIADRPPAGDQWIAQIKWDGVRMLSYYDGSSTELINRRQNYRTKQYPEI
AAAESYCKAGSAILDGEVIALCEGKPSFHEVMRRDSLRKESAIAATVRQIPILYMVFDIL
YCNGVWTLDRPFLERRNLLEEMLRPHPHVQAVPSYNDPTALLAAARAQGLEGIVCKDVNS
VYSPGGKDKRWLKCKIISDLNAVAGGVTFRDGTVNAVLLGLYGDDGRLHYIGHAGTGKMT
VRDWRELTALSHRLAAEDMPFASLPQRVKGAFWIRPELVFKIHFLEWTDSGTLRHPSIQA
RLNLSPSECRLPKR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacgcccatcgttccgtttgagccggtcatcgcagaccggccgcctgccgga
gaccagtggatcgcccagattaaatgggacggcgtccgcatgctttcctattacgacgga
agctccaccgagctgattaaccggcgccaaaattatcggaccaagcaatacccggaaatc
gccgcagcggagagctactgtaaagcgggttccgccatcctggacggcgaggttatcgcg
ctttgcgaaggaaagccctcttttcacgaagtgatgcgccgcgacagcctaaggaaagaa
tcggccatcgctgcgacggtccggcaaattcccattttgtatatggtatttgatatttta
tactgcaacggggtgtggacactggatcggccgttcttggagcgccggaacctacttgag
gaaatgcttcggccccatccgcatgtgcaggccgtgccgagctacaacgatcccaccgcg
ctgctcgcggccgctcgcgcacaagggcttgaaggcattgtttgcaaggatgtgaacagc
gtctactcgccgggcgggaaagacaagcgctggctcaaatgcaaaatcatttccgatctc
aatgccgtcgcgggaggcgtcaccttccgggacggcacggtcaatgccgtgctgcttggg
ctatatggcgatgacgggcgtctgcattatatcggacatgcaggcacagggaaaatgacg
gtaagggactggcgggagttaaccgcactgtcacaccgtctcgctgcagaggacatgccg
ttcgcttcgcttccgcagcgggtcaaaggagccttctggattcgtccggagctggtattc
aagatccattttctggagtggaccgattccggcacgctgcgccaccccagcattcaagcc
aggcttaatctctctccatcggagtgccggctcccgaagcgctaa

DBGET integrated database retrieval system