KEGG   Proteiniphilum saccharofermentans: PSM36_0175Help
Entry
PSM36_0175        CDS       T04672                                 

Definition
(GenBank) putative beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
psac  Proteiniphilum saccharofermentans
Pathway
psac00052  Galactose metabolism
psac00511  Other glycan degradation
psac00600  Sphingolipid metabolism
psac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PSM36_0175
  Lipid metabolism
   00600 Sphingolipid metabolism
    PSM36_0175
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PSM36_0175
Enzymes [BR:psac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PSM36_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2 Glyco_hydro_2_N BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: SCD19011
UniProt: A0A1R3STW9
LinkDB All DBs
Position
I:261844..264297
Genome map
AA seq 817 aa AA seqDB search
MKRAVLSVFFIIFFFLTVSLYAQQRTEFLLEKNWRFSKGDFPQAISDDFNDKNWEEVRIP
HDWAIYGPFDRKHDLQEVAIIQNGERVPTVKTGRTGGLPYMGTGWYRTFFDVENFQSEKQ
IVTLKFDGAMSEARVYVNGKEVCFWPYGYNAFHCDVTEVLHVDGKNNLLAVRLENKPESS
RWYPGAGLYRNVHVIQTNKAHIPVWGTYITTPFVSEEYASVRLRTEIAGDHANIRIVTEI
RDMDNKVVATKDNTQQLDHGRPFEQNFIVENPRLWSPETPYLYTATSTLFVDGTKSDEYT
TRFGIRDIRFIADKGFFLNGEQRKFQGVCNHHDLGPLGAAINEAALRRQLTLLKEMGCDA
IRTSHNMPAPELVKLCDEMGFMMIVENFDEWDVAKCKNGYHRFFDEWAEKDMVNMLRHFR
NNPSVVMWSIGNEVPTQCSSDGYKVARFLQDICHREDPTRPVTSGMDQVSCVLDNGFAAV
VEIPGFNYRTHRYVEAYERLPQNLVLGSETASTVSSRGVYKFPVEKKADALYDDHQSSSY
DLEYCFWSNIPDEDFALADDYHWTLGQFVWTGFDYLGEPSPYDTDAWPNHSSMFGIIDLA
SIPKDRYYLYKSIWNRDEATLHILPHWNWKGREGEVTPVFVYTSYPSAELFINGKSQGKR
TKNNNSLTERYRLMWMDVCYEPGEVKVVAYDENGNKTEEKVVRTAGKPHRIELIPDRNML
SADGKDLAYVNVRVVDKDGNLCPLDDRMIRFTVSGAGEYRAAANGDPTCLDMFHLPQMPL
FNGQLTTIVQAGETGGTLTLEAKAKGVQSSKISIRVE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagccgtattgtctgtattttttatcattttcttttttctgacagtttctctt
tatgctcaacaacgtaccgaattcctgttggaaaagaactggagattcagtaaaggagat
ttcccccaagcgataagcgacgattttaatgacaaaaactgggaggaggtaaggatccct
cacgattgggcaatctacggaccattcgaccggaagcatgatcttcaggaagtagctatt
atacagaacggggagagggtgccgacggtaaagaccggccgcacgggtggccttccctat
atgggaactggctggtaccgtactttttttgatgtggaaaacttccagtccgaaaaacaa
atcgttaccctgaagttcgacggtgcgatgagcgaagcaagggtatatgtaaacgggaaa
gaggtctgcttctggccttacgggtataatgctttccattgcgatgtcactgaagtgctg
catgtcgacggtaagaataacctgcttgccgtacggcttgagaataaaccggagtcttct
cgttggtatccgggggccggactttaccgcaatgtgcatgtgatacaaaccaataaggct
catatccctgtctggggaacgtatatcacgacgccttttgtgtcagaagaatatgcctct
gtacgcctgcggacggaaatagcgggcgatcatgcaaacatacggattgttacggagatc
agggatatggataacaaggtggtggcaacgaaggataatacacagcaactcgaccacgga
cgcccgtttgagcagaactttatcgtggagaatcccaggttatggtcgcccgaaacgcct
tacctctatacggctacgtccaccctatttgttgacggtacaaagagtgacgaatatacg
acccgtttcggtatccgggatatccggtttatcgccgacaagggttttttcctgaacggt
gagcagcggaaatttcagggagtttgcaaccaccatgacctcggccctttgggcgcggct
atcaatgaagctgctctacgtcgccagctgacactcctcaaagagatgggatgcgatgct
atacgtacttcccataatatgcctgcgccggaattggtcaaactttgcgatgaaatgggt
tttatgatgatcgtggagaattttgacgaatgggatgttgccaaatgcaaaaatggttac
caccggttcttcgacgaatgggcggaaaaagatatggtgaatatgttgcgccatttccgg
aataacccttccgtagtcatgtggagtatcggtaatgaagtaccgacacaatgcagcagc
gacggttataaggtggctcgtttcctccaggatatttgccaccgggaagatcctacccgt
cccgtcacttccggaatggaccaggtcagttgtgtgctggacaacgggtttgcagcggtg
gttgaaattcccggattcaattatcgaacccaccgttatgtggaggcatatgaaagactt
ccgcaaaatctggtgttgggttctgaaaccgcttccaccgtcagttcccgtggcgtatac
aagttccccgtggagaaaaaagccgatgcgctttatgacgatcaccagtcctcttcctat
gatctcgaatattgcttttggtcgaatatccccgatgaagattttgctctggctgacgat
tatcactggacactggggcaatttgtctggacaggttttgattacctgggagagccttcg
ccctatgacaccgatgcatggcctaatcacagctccatgtttggaattatagaccttgca
agtattcctaaagaccgctattacctgtacaaaagtatctggaacagggacgaagctacg
ctacatattctcccgcactggaactggaaaggacgcgaaggagaagtaaccccggtgttt
gtgtatacgagttatccctccgccgaactttttattaatgggaaaagccagggaaagcgt
acaaaaaataataattccttaacggaaagatatcgtctgatgtggatggatgtgtgttat
gaaccaggggaagtgaaggtcgttgcttacgatgaaaacggaaataaaacagaggagaaa
gtggttcgtacggcaggtaagccccataggatcgagctgatccccgaccggaatatgcta
tcggctgacgggaaagacctggcttacgtaaatgtgcgtgtggtggacaaagacggcaac
ctatgtccattagatgaccgaatgatccgtttcacggtgagcggtgcaggggaataccgt
gctgccgccaatggagaccccacatgcctggatatgttccaccttccgcagatgccgctt
ttcaacgggcaactcaccaccattgtgcaggccggagaaactggcggaacgcttaccctt
gaagcaaaggcaaaaggagttcaatcgtcaaaaatctctataagggtggaataa

DBGET integrated database retrieval system