KEGG   Pseudomonas stutzeri CCUG 29243: A458_10100Help
Entry
A458_10100        CDS       T02168                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    A458_10100 (ligD)
Enzymes [BR:psc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A458_10100 (ligD)
DNA repair and recombination proteins [BR:psc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A458_10100 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2199231..2201795
Genome map
AA seq 854 aa AA seqDB search
MALDEYQRMRDFAATPEPSGKARGRSRKVQSLQYCIQKHDATRLHYDFRLELDGTLKSWA
IPKGPSLDPSVRRLAVHVEDHPLEYATFEGSIPAGHYGAGDVIVWDRGVWIPQGDPQEGY
RKGKLKFSLEGEKLAGSWNLVRTHMAGKKEQWFLIKSHDEAAREEGEYDVVTAEPNSVLS
DRTLVPRKRGAAKARVAEAPAKPVKAPARKRASRKKSDAVKLEGAVPAKLPETFKPQLAT
LVDAVPSGDWRYEIKFDGYRMLARIDAGKVALFTRNGHDWTAKMPQQAAALAGLGLESGW
LDGEVVVPNEEGAPDFQALQNAFEAGRSGSILYYLFDVPYLNGMDLRDVPLEQRRAALRE
VLEGSDSELLRFSDDFTEQPDSILESACQMKLEGLIGKRAGSSYTSRRSSSWVKIKCSNR
QEFIIVGYTEPKGTRTGFGALLLGLHDDSGKLLYAGKVGTGFNQATLKSLHKQLKKLEAD
KSPLAKAAPAADVRGAQWLKPELMCEAAYAEMTRQGVVRHSVFHGLRSDKPADAITRERA
KPASRSSKAEQRQTDPIGSGRIKISSPERIIDPSSGITKIEVARFYAQIAPWALPQLRAR
PLALVRAPEGITGELFFQKHADKLAIPHITQLDPALDPKHGALLVIDSAEALVGAAQMGT
IELHCWNAVAPELEHPDRFVLDLDPDPALPWKSMLEATQLTQTLLDEIGLTSFLKTSGGK
GIHIVVPLDPVHGWSEVKAFSQAIAKYLAKLLPSHFSAVSGPKNRVGRIFIDYLRNSRGA
STVAPYSVRAREGLPVSVPIHREELADLKGANLWTVRNLLERLQELGDDDPWADMTRVRQ
TITAQMRERLAMPA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgacgaataccagcgcatgcgcgattttgccgccacgcccgagccgtcgggt
aaggcgcgcggcaggtcacgcaaggtccagagcctgcagtactgcatccagaagcacgac
gccacgcggttgcattacgactttcgcctggagctggatggcacgctgaagagctgggcg
atccccaaaggccccagccttgacccgagcgtgcgccggctcgcagtgcatgtggaggat
cacccgctggaatatgccacgttcgagggctccattcctgccgggcattacggcgcgggc
gatgtgatcgtctgggatcgcggcgtgtggataccgcaaggtgatccgcaggagggctat
cgcaagggcaagctcaagttcagcctcgagggcgaaaaactcgccggcagctggaatctg
gtgcgcacgcacatggctggcaagaaggagcagtggttcctgatcaagtcccatgacgag
gccgcgcgcgaggagggtgagtacgacgtcgtcaccgccgagccgaacagcgtgctcagc
gatcgcacgctggtcccacgcaaacgcggagcggccaaggctcgcgttgcggaagcgccg
gccaagccagtcaaggcgccggcaagaaagcgagcgtcacgcaagaagagcgacgcggta
aagctggaaggagccgtcccggccaagttgccggagacgttcaagccgcagctggcgacg
ctggtggacgccgtgccgagcggcgactggcgctacgagatcaagttcgacggctaccgc
atgctcgcccgtatcgacgccggcaaggtcgcgctgttcacccgcaacggccatgactgg
acggcgaagatgccgcagcaggcggccgcgcttgccggactcgggcttgaatccggctgg
ctcgacggcgaagtggtggtgccgaacgaggagggcgctccggacttccaggcattgcag
aacgcgttcgaagccggacgcagtggaagcattctctattacctgttcgacgtgccctat
ctgaacggcatggacctgcgggacgtgccgctggaacagcgtcgcgcggcgttgcgtgaa
gtgctggaaggcagcgacagcgaattgctgcgtttctccgacgatttcaccgagcagccg
gacagcattctggaaagcgcctgccagatgaagctcgaaggcctgatcggcaagcgagcg
ggcagctcctatacctccaggcgcagcagcagctgggtcaagatcaagtgcagcaaccgg
caggaattcatcatcgtcggctacaccgagcccaagggcacgcgcaccgggttcggcgcc
ctgttacttgggctgcatgacgacagtggaaagctgctctatgcaggaaaggtcggcact
ggcttcaatcaggccacgctgaaaagcctgcacaagcagttgaagaagctggaagccgac
aaaagtcctttggccaaggcggcacctgctgccgatgtgcgcggcgcgcaatggctcaaa
cccgaactgatgtgcgaggctgcctacgcggagatgacccgccaaggcgtggtccgccat
tcggtgttccatggcctgcgctcggacaaacccgccgacgccattacccgtgagcgggcc
aagcccgccagtcgtagcagcaaagccgagcagcggcagacagaccccatcggcagcggg
cggatcaagatatccagtcccgagcgaatcatcgaccccagcagcgggatcaccaagatc
gaagtggcccgcttctacgcgcagatcgcgccctgggccctgccgcagctgcgagcgcgc
ccgctggccctggtgcgcgccccggagggcatcaccggcgagctgttcttccagaagcac
gccgacaaattggccatcccgcacatcacccaactcgacccggcgctagacccgaagcac
ggtgcgttactggtgatcgacagcgccgaagcgctggtcggcgccgcgcagatgggcacc
atcgagctgcactgctggaacgcggtagcgcccgaactggagcatccggatcgcttcgtg
ctcgacctcgacccggacccggcgctgccctggaagagcatgctcgaagccactcagctg
acccagacgctgctggacgagattggcctgacctcgttcctcaagaccagcgggggcaaa
ggcatccacatcgtcgtaccgctcgatccggtacacggctggagtgaggtgaaggccttc
agtcaggccatcgccaagtacctggcaaagctgctgccgtcgcatttttccgccgtaagc
gggccgaagaaccgggttggacgcatcttcatcgactacctgcgcaacagccgtggcgcc
agtaccgtcgccccctattcggtgcgtgcccgcgagggcctgccggtctccgtgccgatc
caccgcgaagaactggcggacctcaagggcgccaatctctggaccgtacgcaatctgctg
gagcgcctgcaggaactgggcgacgacgatccctgggcggatatgacgcgggtcaggcag
accatcaccgcgcagatgcgcgaacgtctggccatgccggcttaa

DBGET integrated database retrieval system