KEGG   Pseudoxanthomonas spadix: DSC_04770Help
Entry
DSC_04770         CDS       T01643                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSC_04770
  Energy metabolism
   00680 Methane metabolism
    DSC_04770
Enzymes [BR:psd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DSC_04770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
822015..824726
Genome map
AA seq 903 aa AA seqDB search
MSASSPVSEYAAPDLPLRDDVRRLGAVVGDMLAEQVSPEFLDRVEAIRTAAIARRQKGES
TQGLAQTLAGMPAGDAQALIRAFSAYFQVVNIAERVHRIRRRRDYQRQGDAPQPEGLHAS
LLKLRAQGVDLAEASAWLERIDLEPVFTAHPTEAVRRALLEKEQLMVASLVAGLDKVRTP
GEAAADAARFRMALTAAWQTADSSPVRPTVDDEREHVGFYLTEVLYRVIPVFYESLEHAF
TATYGSAPELPRVLRFGTWVGGDMDGNPNVDAGTIAATLRAQRHAIVHRYQAELKALGSL
LSQSTQLVQVSPEVLRRVDQYRALLPEAAARARPRHADMPYRLLLDLMRARLHATLDEQD
RGYAGPEAFGQDVALILHSLEANRGVHAGWFAVRRLAWRVRTFGFHLARLDVRQESGVHA
RALAAALGDAGFEARDASARAALLQPYAAGEQLLPASTEEGNSRLDAVFAALSQARRLHG
ADALGAYIISMAHSRADVLTVLALARRGGLVDDQGQVPLDIAPLFETVEDLRHGPEVLRE
LATDPVYRRHLAARGDTQMVMLGYSDSGKDGGTTASRWGLQRGQVELLETAHALGIRLTF
FHGRGGSISRGGGKTTRAVDASPRGSVDGRLRVTEQGEVIHRKYGIRALAVRSLEQSLGA
VLVSSIRPRPPEPREAQWRRIMDTVSRASNRAYRDFVGAPGFMDYFRSATPIDVIERMTL
GSRPSRRLGQDAALDNLRAIPWVFAWSQARATIPGWYGVGSGLAAAVDEFGEDAVREMGR
DWPFVRTFLDDIAMVLAKGDLDIAALFSQLSGELHGRFFPLIQAEHALTRQWLLRLNGSD
TLLQHDQRLDLSIRLRNPYVDPMSLLQVDLLRRWRAAGREDEGLLRALVASVNGVSQGVQ
NTG
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcatcctcgccggtttccgagtacgccgcgcccgacctgccgctgcgcgatgac
gtgcgccggctgggcgcggtggtcggtgacatgttggccgagcaggtctcgcccgagttt
ctggaccgggtcgaggccatccgcaccgccgccatcgcccgtcgccagaaaggcgagagc
acccagggcctggcccagaccctggccggcatgcctgccggcgacgcacaggcgctgatc
cgtgccttcagcgcctacttccaggtggtcaacatcgccgagcgcgtgcatcgcatccgc
cgccgccgcgattaccagcgccagggcgatgcgccgcagcccgaaggcctgcatgccagc
ctgctcaagctcagggcgcagggcgtggacctggccgaagccagcgcctggctggagcgg
attgacctggagccggtgttcaccgcgcatccgaccgaggcggtacgccgggcgctgctg
gaaaaggaacagctgatggtggccagcctggtggccggactggacaaggtgcgcacaccg
ggcgaggcggccgccgatgcggcgcgctttcgcatggcgctgaccgcggcctggcagacc
gccgactcctcgccggtgcggccgaccgtggacgacgagcgcgagcatgtcggcttctac
ctgaccgaagtgctgtaccgggtcattccggtgttctacgaatcactggagcacgccttc
accgcaacctacggcagcgccccggagctgccacgcgtgttgcgcttcggcacctgggtg
ggcggcgacatggacggcaacccgaacgtggatgccggcaccattgccgcgaccctgcgc
gcgcagcgccacgcgatcgtgcatcgctatcaggccgaactgaaggcgctgggcagcctg
ctcagccagtccacgcaactggtgcaggtctcgcccgaggtgctccggcgcgtggaccaa
taccgcgcgctgctgccggaggcggccgcccgcgcccgcccgcgccacgccgacatgcct
taccgcctgctgttggacctgatgcgtgcgcgcctgcacgccaccctggacgagcaggac
cgcggctatgccgggcccgaggccttcggccaggacgtggcgctgatcctgcacagcctg
gaagccaatcgcggcgtgcatgccggctggttcgcggtgcggcggctggcctggcgggtg
cgcaccttcggcttccatctggcgcggctggatgtgcgccaggaatcgggcgtgcatgcg
cgcgcgctcgccgcggcattgggcgatgccggcttcgaggcacgcgatgccagcgcgcgc
gccgcgttgctgcagccctatgccgcgggcgaacagctcctgccggccagcacggaggag
ggcaattcgcgcctggacgcggtgttcgccgcgttgagccaggcgcggcgcctgcacggt
gccgacgcgctgggcgcctacatcatctcgatggcgcacagccgcgccgacgtgctgacc
gtgctcgccctggcccgtcgcggcgggctggtggacgatcagggccaggtaccgctggat
atcgcgcccctgtttgaaaccgtggaggacctgcgccacggcccggaagtgctgcgcgag
ctggccaccgatccggtctatcgcaggcacctggccgcgcgcggcgacacccagatggtg
atgctgggctattcggacagcggcaaggacggcggcacgaccgcctcgcgctggggcctg
cagcgcggccaggtggagctgctggaaacagcgcacgcgctgggcatcaggctgaccttc
ttccatggccgcggcggctcgatcagccgcggtggcggcaagaccacccgggcagtggat
gcctccccgcgcggcagcgtcgatggccgcctgcgcgtgaccgagcagggcgaagtcatc
caccgcaagtacggcatccgcgcgctggcggtgcgttcgctggagcagtcgctgggcgcg
gtgctggtgtccagcatccgcccacgtccgcccgagccgcgcgaggcacagtggcgcagg
atcatggacaccgtgtccagggccagcaatcgcgcctaccgggacttcgtcggcgcgccc
ggcttcatggactacttccgcagcgccaccccgatcgacgtgatcgaacgcatgaccctg
ggctcgcgcccctcgcgccggctgggccaggacgcggccctggacaacctgcgtgcgatc
ccgtgggtgttcgcctggagccaggcgcgcgccaccattcccggctggtacggcgtgggc
agcggcctggccgcggcagtggacgagttcggcgaggacgcggtgcgcgagatgggccgc
gactggccgttcgtgcgcaccttcctggacgacatcgccatggtgctggccaagggcgac
ctggacatcgccgcgctgttctcgcagctgtccggcgagctgcacgggcggttctttccg
ctgatccaggccgagcatgcgctgacccggcaatggctgctgcgcctcaatggcagcgac
accctgctccagcacgaccagcgcctggacctgtccatccgcctgcgcaacccgtatgtg
gacccgatgagcctgctgcaggtggacctgctgcgccgctggcgcgccgccgggcgcgag
gacgaaggcctgctgcgcgcgctggtggccagcgtcaacggcgtttcgcaaggcgtgcag
aacaccggttga

DBGET integrated database retrieval system