KEGG   Pseudoxanthomonas spadix: DSC_06070Help
Entry
DSC_06070         CDS       T01643                                 

Definition
(GenBank) dipeptidyl carboxypeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
psd  Pseudoxanthomonas spadix
Brite
Enzymes [BR:psd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     DSC_06070
Peptidases [BR:psd01002]
 Metallo Peptidases
  Family M2
   DSC_06070
Exosome [BR:psd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DSC_06070
CD molecules [BR:psd04090]
 Proteins
  DSC_06070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1108702..1110783)
Genome map
AA seq 693 aa AA seqDB search
MKPRHLVFATAACLSLAGLSGCGSDQPATPDGVPPAPKGETAEEFVERINTGLRAQSPEL
NAAQWLSSTYINDDSQRVASRANERALTQLNAWITQSRRFEGKQMPPQTARAIQLLRLMT
AMPAPQDPQKLAELTRIATQMEGMYGAGTYCTGEGQARSCRQLGALESVLASSRDYDAQL
DAWQGWHSIAPPMRERYTRFVALVNEGAQDMGFADAGELWRSGYDMAPGEVAAETNRLWS
QVKPLYEQLHCYARGKLEAHYGMRGQVDGGLLPAHLLGNMWQQDWSNLWDLLQPYPEAGS
LDITGALQALDDAQYEKTLKTAALAPEDPFEGARDAAYTAQLQALGHDPDDAERTRLNRL
AYDQAIARVADLRRAAALAGAKAMAARAQDFYTSLGMPSLPKSYWQKSQFIKPRDREVVC
HASAWDMDMTGDVRTKMCIEPDEESFTTLYHELGHLYYDLAYNSQPPVFQGGANDGFHEA
IGDTIVLAMTPRYLASIGLVKDAPTGEQALVNAQMRMALSKVAFLPFGLMIDRWRWGVFD
GSITPEHYNSAWWQLKAQYQGVAPATPRGEEYFDAGAKYHVPGNTPYTRYFMAHILQFQF
YKALCDASGHTGPLNQCSFYGNKRAGQKFWAMLQKGSSQPWPDTLKGLTGSDRMDAAPML
EYFQPLDAWLKQQNEGKTCGWSAPAASQRSPRP
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccacgccacctcgtgtttgccaccgccgcgtgcctgtcgctggcgggcctgtcc
ggctgcggttcggaccaaccagccacgccggatggcgtaccaccggcgccgaagggcgag
accgccgaggaattcgtcgagcgcatcaataccggactgcgcgcccagtcgcccgagctc
aatgcggcgcagtggctctcgtccacctacatcaacgatgacagccagcgggtggcgtcc
agggccaacgaacgcgcgctgacccagctcaatgcctggatcacccagtcgcggcgtttc
gagggcaaacagatgccgccgcagaccgcacgtgcgatccaattgctcaggctgatgacc
gccatgcccgcgccgcaggatccgcagaagctggccgaactcacccgcatcgccacccag
atggaaggcatgtatggcgccggtacgtactgtaccggcgaaggtcaggcacgcagctgc
cgtcaactgggcgcgctggaaagcgtgctggccagcagccgcgactacgacgcccagctc
gacgcctggcagggttggcattcgatcgccccgcccatgcgcgagcgctacacgcgcttt
gtcgccctggtcaacgaaggcgcgcaggacatgggctttgccgatgccggcgagctgtgg
cgcagtggctacgacatggccccgggcgaagtggccgccgagaccaatcgcctgtggagc
caggtcaagccactctacgagcagttgcattgctacgcgcgcggcaagctggaagcgcac
tacggcatgcgcggccaggtcgatggcgggctgctgccggcgcatctgctgggcaacatg
tggcagcaggactggagcaacctgtgggacctgctgcagccctaccccgaggcgggcagt
ctggacatcaccggcgcgctgcaggcgctggacgatgcgcagtacgaaaagacgctcaag
acggccgcacttgcgccggaggatccgttcgagggcgcgcgcgatgccgcctacaccgca
cagctgcaggcgcttggccacgaccccgacgatgccgaacgcacgcgcctgaaccgcctc
gcctacgaccaggccatcgcccgcgtcgccgacctgcgccgcgccgccgccctggccggc
gccaaggccatggccgcccgcgcacaggacttctacacctcgctgggcatgccgtcgctg
ccgaagagctactggcagaagtcccagttcatcaagccgcgtgaccgcgaggtggtctgc
catgccagtgcctgggacatggacatgaccggcgacgtgcgcaccaagatgtgcatcgaa
ccggatgaggaaagcttcaccacgctctaccacgaactgggccacctctattacgacctg
gcctacaacagccagccgccggtgttccagggcggggccaacgacggcttccacgaagcc
atcggcgataccatcgtgctggcgatgacgcccaggtacctggcgtccatcggcctggtc
aaggacgcgcccaccggcgaacaggcgctggtcaacgcccagatgcgcatggccctgtcc
aaggtcgccttcctgccgttcgggctgatgatcgaccgctggcgctggggcgtgttcgac
ggctcgatcacgccggagcactacaacagcgcctggtggcagctgaaggcgcagtaccag
ggcgtggccccggcaacaccacgcggcgaggaatacttcgacgccggcgccaagtaccac
gtgccgggcaacacgccctacacgcgctacttcatggcccacatcctgcagttccagttc
tacaaggcactgtgcgatgcctccggccataccggtccactcaaccagtgcagcttctat
ggcaacaagcgcgccggccagaagttctgggcgatgctgcagaaagggtccagccaaccc
tggccggacacgctcaagggcctcaccggcagcgacaggatggacgccgcgccgatgctc
gaatacttccagccgcttgatgcgtggctcaagcagcagaacgaaggcaagacctgcggc
tggagcgcgccggctgccagccagcgttcgccgcggccctga

DBGET integrated database retrieval system