KEGG   Pseudoxanthomonas spadix: DSC_09360Help
Entry
DSC_09360         CDS       T01643                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DSC_09360
Enzymes [BR:psd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DSC_09360
Transporters [BR:psd02000]
 Other Transporters
  Pores ion channels [TC:1]
   DSC_09360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C_3 GST_C GST_N_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AER56520
UniProt: G7UWL3
LinkDB All DBs
Position
1838485..1839096
Genome map
AA seq 203 aa AA seqDB search
MKLYYSPGACSLSPHIALREAGLDFELVKVDLASKKTASGQNYLEINPAGYVPCLQLDDG
RTLTEGPAIVQYVADQVPGKQLAPTNGSFERYRLQQWLNFISSELHKSFSPLFNPASSDD
WKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVLGWSAYVKLDLSPWPALQA
FQGRVGGREAVQSALRAEGLTKE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactacagtcctggtgcctgctcgctgtccccgcacattgcattgcgcgag
gccggcctggatttcgagctggtaaaggtcgacttggcaagcaagaagactgcctccggg
cagaactacctagagatcaacccggccgggtacgtgccttgcctgcagcttgacgacggc
cgtaccctgaccgagggccccgccatcgtgcaatacgtggccgatcaggtgcccggcaag
cagctggcgccgaccaacggcagcttcgagcgctaccgcttgcagcaatggctgaacttc
atctcgagcgaactgcacaagagcttcagccccttgttcaaccctgcgtccagcgacgac
tggaaaaacgccgtgcggcagagcctgaacacccgcctggggcaggtcgcgcgacagctc
gagcatgcgccctatctgctgggtgaccaattgagcgtggccgacatctatctgtttgtc
gtgctcggttggagcgcctatgtcaagcttgatctctcgccctggccggcgctgcaggcc
ttccaaggccgtgtcggaggccgcgaagcggtacagtctgcgcttcgcgccgaaggcttg
accaaggagtga

DBGET integrated database retrieval system