KEGG   Pseudoalteromonas sp. OCN003: OM33_11595Help
Entry
OM33_11595        CDS       T03513                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pseo  Pseudoalteromonas sp. OCN003
Brite
Enzymes [BR:pseo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     OM33_11595
Peptidases [BR:pseo01002]
 Metallo Peptidases
  Family M2
   OM33_11595
Exosome [BR:pseo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OM33_11595
CD molecules [BR:pseo04090]
 Proteins
  OM33_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2486694..2488523
Genome map
AA seq 609 aa AA seqDB search
MTSFKLSLPAILVASAVALTGCNANNSEKSTATQQVTAQDAKAFLANTETELMALYNEVS
RAEWIYANFITHDTSSLSAAANEKMTAAVVRLANEASKFDKLDLDEDSRRKLDKLKLALT
LPAPQDPAKTAELSKIVAELGGLYGKGKYCKEDGKCLSLGDMTATMATSRDYDELLDIWT
GWREVAKPMRPLYEQQVKLTNQGANELGYADTGAMWRSKYDMPADDFAKELDRIWGQVKP
LYNSLHCHVRAKLGEKYGEDKVPQDKPIPAHLLGNMWAQTWGNIYDVVAPANADPGYDVT
ELLAKHNYDELKMVRGAEKFFTSMGFAPLPETFYERSLFTKPQDRDVQCHASAWNLDSKD
DLRIKMCIQRTGEEFSVIHHELGHNFYQRAYNTQPIYYQESANDGFHEAIGDTIALSVTP
GYLKEIGLLDEVPDESKDIGLLMKMAMDKIAFIPFGLLVDQWRWKVFSGEVTPENYNQAW
WELREKYQGVAAPVARTEEHFDPGAKYHVPGNTPYTRYFLAHILQFEFHRALCEIAGSKE
SIHRCSVYNSKEAGERLDAMLKMGSSRPWQEALASVTGKPEMDATAILDYFAPLQKYLDE
QNKGRQCGW
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatttaaactctcactaccagcaattttggtagcatcagccgttgcgttaacc
ggctgtaatgcgaacaattcagaaaaatcaactgcaacacaacaagtaacagcacaagat
gcaaaagcgtttttagcaaatactgaaacagaattaatggcgctttacaacgaagtaagc
cgtgcagaatggatttacgctaacttcattactcatgacacttcaagtctttctgctgct
gcaaacgaaaaaatgactgctgccgtagttcgtttagcgaatgaagcgtctaagttcgac
aaattagacctagacgaagatagccgccgtaagctagataaacttaagctagcactcacc
ctgcctgcaccacaagatccagctaaaacagctgagctttcaaaaatcgttgctgaactt
ggcggcctgtatggtaaaggtaaatactgtaaagaagacggtaagtgcttaagccttggc
gatatgacagcaaccatggcaacaagccgtgattacgacgagctacttgatatttggact
ggctggcgcgaagttgctaaaccaatgcgtccactttacgagcaacaagttaaattaacg
aaccaaggtgctaacgagcttggctatgcagatacaggtgcaatgtggcgtagtaaatac
gatatgccagctgatgattttgcaaaagagctagatcgtatttggggtcaagttaagcca
ctttataactctctacactgtcatgttcgcgcaaaactaggcgaaaaatatggtgaagac
aaagtaccacaagacaagccaattccagcacacttactgggtaacatgtgggcacaaacg
tggggcaacatctacgatgtagttgcacctgcgaatgctgatccaggttacgatgtaact
gaattacttgctaagcacaactatgatgaactaaaaatggtgcgcggtgcagagaaattc
tttacgtcaatgggctttgcaccattaccagagacattctacgagcgctcactgtttact
aaaccacaagatcgcgacgtgcaatgtcacgcatcagcttggaacttagatagcaaagac
gatttacgtattaagatgtgtatccaacgtactggtgaagaattctcagtaattcaccac
gaactaggccacaacttctaccagcgcgcttacaacacgcaaccaatttactaccaagaa
agtgccaacgatggcttccacgaagcaattggtgacactatcgctctttctgtaacaccg
ggttacttaaaagagattggtttacttgatgaagtaccagatgaatcaaaagatatcggt
cttcttatgaaaatggcaatggataaaattgcatttatcccatttggcctacttgttgac
caatggcgctggaaagtattctcaggtgaagtaacgccagaaaactacaaccaagcatgg
tgggaactgcgtgagaagtatcaaggtgtagcggctcctgtagcacgtactgaagaacac
tttgatccaggcgcaaaataccacgtaccaggtaatacaccttatacacgttatttccta
gcgcacattctacaatttgaattccaccgtgcactgtgtgaaatcgcaggtagcaaagag
tctattcaccgttgtagcgtttataattcaaaagaagcaggcgaacgtttagatgcgatg
ctgaaaatgggttctagccgtccatggcaagaagcgcttgcaagcgtaacgggtaaacca
gaaatggatgcaactgcaattcttgattactttgcaccattacaaaaatatttagatgag
caaaacaaaggccgccagtgcggttggtaa

DBGET integrated database retrieval system