KEGG   Pseudonocardia sp. EC080610-09: AD006_19015Help
Entry
AD006_19015       CDS       T04146                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pseq00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AD006_19015
Enzymes [BR:pseq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AD006_19015
DNA repair and recombination proteins [BR:pseq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AD006_19015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4121578..4122468)
Genome map
AA seq 296 aa AA seqDB search
MTNPDKVLYPATGTTKAEVLGHYLAVAEAMLPHLESRPATLKRWPDGVESSSFFEKNVSR
HAPSWLRTARVGTPGGRSESADFAVITDAEGLAWAANLAALELHVPQWRLGPRDGRHPPD
RVVFDLDPGEGTTVVDCCRIALRLRALLDEHGLPVYPSTSGGKGMQLYLPVRVTEPERTS
EFAREVAERLAAEHPRETIAVMTRARRRGKVFVDWSQNNTAKTTIASYSLRGRERPTVAT
PVTWDEVDACREAGDLVFTCDDLPGRLDTHGDLMRPLLDTEGFRLPRGGAIFEVPG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ctgaccaacccggacaaggtgctgtacccggccaccggcacgacgaaggccgaggtcctc
gggcactacctcgccgtcgccgaggcgatgctgccgcacctggagagccgccccgccacg
ctgaagcgctggccggacggggtggagtcgtcgtcgttcttcgagaagaacgtgtcccgg
cacgcgccgtcgtggctgcgcacggcacgggtcggcacgcccggcggccggtccgagtcg
gccgacttcgcggtgatcaccgacgccgaggggctggcctgggcggcgaacctcgcggcg
ctggagctgcacgtcccgcagtggcggctcggcccgcgcgacggcaggcacccaccggac
cgtgtcgtgttcgacctcgatcccggtgaggggacgaccgtcgtcgactgctgccggatc
gcactgcggctgcgcgcgctgctcgacgagcacgggctgccggtgtacccgtcgacgtcc
ggcggcaagggcatgcagctctacctgccggtgcgggtcacagagcccgagcgcacctcc
gagttcgcccgggaggtcgccgagcggctcgccgccgagcacccgcgggagacgatcgcg
gtgatgacccgcgcccgtcgccggggaaaggtgttcgtcgactggagccagaacaacacg
gccaagacgacgatcgcctcgtactcgctgcgcgggcgcgagcggccgaccgtggccacc
cccgtcacctgggacgaggtggacgcctgccgcgaggccggggacctggtgttcacctgc
gacgacctgcccggccggctggacacccacggtgacctgatgcgtcccctgctggacacc
gagggtttccggctcccccgtggtggggcgatcttcgaggtgccaggctga

DBGET integrated database retrieval system