KEGG   Pseudonocardia sp. EC080610-09: AD006_26080Help
Entry
AD006_26080       CDS       T04146                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
pseq  Pseudonocardia sp. EC080610-09
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
5664427..5665497
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVKPMLAKPASSIPDGRLYEPKWDGFRSIVFRDGDDVEIGSRNERPMTRYFPE
VVEAVRANFPDRAVIDGEIVVADPANNRLDFEALQQRIHPAASRVTLLSTETPASFVAFD
LLALGADDLTGLPFAERRDLLESALADAAPPVHLTPVTDDTGTARRWFDRFEGAGLDGLI
AKDPAGTYQPDKRVMTKIKHERTADCVVAGYRVHKSGPDAVGSLLLGLHDERGVLVSVGV
VGAFPMARRRELMTELQPLVTGFDEHPWAWAKQLEGERTPRKSETSRWNAGKDLSFVPLR
PERVVEVRYDYMEGARFRHTTQFVRWRPDRAPESCTYEQLDRPVGFDLAEVLAGRG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcccgtgatgcccccggtgaagccgatgctcgccaagcccgcgtcgtcgatc
cccgacggccggctgtacgagcccaagtgggacggcttccgctcgatcgtcttccgggac
ggtgacgacgtcgagatcggctcccgcaacgagcggccgatgacgcgctacttccccgag
gtcgtcgaggcggtgcgggcgaacttcccggaccgcgcggtgatcgacggcgagatcgtc
gtcgcggaccccgcgaacaaccgcctcgacttcgaggcgctccagcagcggatccatccc
gccgcgagccgggtgacgctcctgtcgaccgagacgccggcgtcgttcgtggcgttcgac
ctgctcgcgctcggcgccgacgacctgaccgggctgccgttcgccgagcgtcgcgacctg
ctggagtccgcgctcgccgacgccgccccgccggtgcacctcacccccgtcaccgacgac
accggcaccgcccggcgctggttcgaccggttcgagggcgccgggctcgacggcctgatc
gcgaaggacccggcggggacctaccagccggacaagcgcgtcatgaccaagatcaagcac
gaacggaccgcggactgcgtcgtcgccgggtaccgggtgcacaagtccgggccggacgcc
gtcgggtcgctcctgctcggcctgcacgacgagcgcggggtgctggtgtcggtcggtgtc
gtcggcgcgttcccgatggcacgcagacgggagctgatgaccgagctccagccgctggtc
accggcttcgacgagcacccgtgggcctgggcgaagcagctcgagggcgagcgcaccccg
cgcaagtccgagacgagccgctggaacgccggcaaggacctctcgttcgtgccgctgcgc
ccggagcgggtcgtggaggtgcgctacgactacatggagggcgcccggttccggcacacc
acccagttcgtgcggtggcgcccggaccgcgccccggagtcgtgcacctacgaacagctg
gaccggccggtcgggttcgacctggccgaggtcctcgcgggccgcggctga

DBGET integrated database retrieval system