KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0465Help
Entry
Pse7367_0465      CDS       T02369                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pse7367_0465
   00020 Citrate cycle (TCA cycle)
    Pse7367_0465
   00620 Pyruvate metabolism
    Pse7367_0465
Enzymes [BR:pseu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pse7367_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(591859..593184)
Genome map
AA seq 441 aa AA seqDB search
MIHEIFMPALSSTMTEGKITSWVKSLGDKVEKGETVVIVESDKADMDVETFYEGYLGAIA
VPEGEVAPVGAAIAYVAETEAEIEAAKQKAAQSTTAPSAAPAATNNASSASSTSNNASAS
SPEAATTTTTIAAPARKKGDRIIASPRAKKLAKANNLDLGVINGTGPNGRITAADVEARL
KPSTPSASAPALPAQPASAIVATTPPAIVAVPTPAPATATVQPLSTFQNAVIRNMNWSLA
VPTYHVAYSITTTALDALYKQIKPKGVTMTALLAKAVAITLQKHPLLNASYSDQGIAYKS
DINVAVAVAMDDGGLITPVLPKADQIDIYSLSRHWKELVGKARAKQLQPDEYSTGTFTIS
NLGMFGVDSFDAILPPGTGAILAIGGSKPQPVITADGAIAIRSQMKVNITCDHRVIYGAH
AAQFLQDLAKLIETNAQSLVL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaaattttcatgcctgcgcttagctccaccatgaccgaaggaaagattacc
tcctgggtgaaatctctcggtgacaaagtcgaaaagggcgaaaccgtggtgattgttgag
tccgacaaggcagatatggacgtagaaactttctatgagggctatttgggcgcgatcgct
gttcctgaaggtgaggttgccccagttggtgccgcgatcgcctatgtggcagaaaccgaa
gccgagatcgaagccgccaaacaaaaagcagcccaatcaaccactgcccccagcgctgcc
cctgctgccactaataatgctagtagcgctagtagtaccagtaataatgctagcgcctcc
agccctgaagcagcgaccacaactactactattgctgcaccagcacgtaaaaaaggcgat
cggatcattgcctcccctcgcgccaagaaattagccaaagccaataatctagatctaggc
gtgattaatggcactggccccaatggtcggattacggcggcggatgtggaagcccgatta
aaaccatctacaccctctgcctctgccccggctttgcctgcccaaccagcatcagcgatc
gtggcaactactccaccggcgatcgtggctgtacctacgcctgctccggcgaccgcaact
gtccaaccgctatccacgttccagaatgcagtaatccgcaacatgaattggagtctggcg
gtgccgacttatcatgtagcctatagcattactactacggcgctggatgccctctataag
caaattaagcccaagggcgtaaccatgaccgcgctgttggctaaggcggtagcaattacc
ttacaaaagcacccgttgctcaatgccagctacagcgaccaagggatcgcctacaagagc
gacattaatgtggcggtggccgtggcgatggatgatggtggtctgattacgccagtgttg
ccaaaggcagaccagatcgatatttatagcctgtcgcgccattggaaagaactagttggc
aaagcccgcgccaagcaattgcaaccggatgaatattccactggcaccttcacgatctca
aatctgggcatgtttggcgtggattcttttgatgcaattctgccacctggtactggcgcg
atcctggcgatcggtggttccaaacctcagcccgtgattactgctgatggggcgatcgca
attcgctcgcaaatgaaagtaaacattacctgcgatcaccgcgtgatctatggtgcccat
gcggcacagttcttgcaggatttggccaagttgattgaaaccaatgcccaatctctggtg
ctataa

DBGET integrated database retrieval system