KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2737Help
Entry
Pse7367_2737      CDS       T02369                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pse7367_2737
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pse7367_2737
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Pse7367_2737
   00680 Methane metabolism
    Pse7367_2737
Enzymes [BR:pseu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Pse7367_2737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3446204..3449140)
Genome map
AA seq 978 aa AA seqDB search
MSSPTFSLSESLIQIVNQETDLRLSDSRLRYRIKIIEELWQSVLVQECGQGMVDLLLQLR
SMCSPEGQAPQYPAQEVLKVVESLSLEESITAARAFAIYFQLINIIEQQYEQEEQQQAQI
DRIKGESKFLDGTFRWLFPELKRQNVPPRFIQDLIDKLDIRLVFTAHPTEIVRHTIRDKQ
RQIAVMLKELDRLTDGTYSDDIDYGQMMPLSWEAENLREQIADEIRLWWHTDELNQSKPT
VIDEADYTLHYFDEVLYDAIPDLYERVEKALTETFPHLNPPKYNFCKFGSWVGSDRDGNP
SVKPDITWRTACYQRGLVIEKYISSVNGLVRLLSVSQNLIDISTDLLTSLGQDQTHMPEV
YNQFAVRYRQEPYRLKLQYILKRLRNTRDRNDRLNEIGWQAADQVMPIKPTDHSVYSGAK
DFETELRLVANSLKGSGLHCKALQTLIRQVEVYGFHLANLDIRQESRKHSGAITEITSSL
KILDTPYDQLSESEKVNWLTKELQTLRPLIPADLHFGDFTNEIIETFRMLAKLQQEFSIE
ICNTYIISMSESVSDVLEVLLLAKEAGLYNPATGTGSVSVVPLFETVEDLQGAKRIMQEL
FDLRLYRNYLNHHEHRQEVMLGYSDSNKDSGFLSSNWEIYKAQLSLQKLAEQYGIWLCIF
HGRGGSVGRGGGPTYQAILAQPGRSIKGAIKITEQGEVLASKYSLLEIALHNLETVATGV
IQAALLPSSSDTLGSWLQTLEDLATRSRQVYRELIHENPNLVDFFHEVTPIEEISHLQIS
SRPARRSAGKKDLSSLRAIPWVFSWTQSRFLLPSWYGVGTAIDEFLQQHPEHLTLMQFFY
EKWPFFRTTISKVEMTLAKSDLQIARHYVRELAPAAKQELYMQLFEQIANEYYRTCKIIL
QITGHHQLLDGDPSLQRSVQLRNGSIVPLGFIQAALIKRLRQYNSDPINLRSRYSRTELL
RGALLTINGIAAGMRNTG
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaccgactttttcactttcagagtcattgatccaaattgtcaaccaagaaact
gacctgcgcttgagtgattcacgcttgcgttaccggatcaagataatcgaagagttatgg
cagtcggttttggtgcaagaatgtggccagggaatggtagatttgctccttcagcttcga
tcgatgtgttcgccggaaggccaagcgccccaatatccagcccaagaagtattaaaggta
gttgaaagcctcagcctggaggaatcgatcacagcagccagggcatttgcgatttatttt
cagttaattaatattattgagcagcaatacgaacaagaagaacaacagcaagcgcaaatc
gatcggattaagggcgagtctaagttcctggatggcacttttcggtggctgttcccagaa
ctaaagcgccagaatgtaccgcctcgttttattcaagatttaatcgataagctggatatt
cggcttgtattcaccgcccaccccaccgaaattgtgcggcatacgattcgggataagcaa
cgtcagatcgcggtgatgctcaaagaactcgatcgcctcaccgatggcacctatagcgat
gatattgactatggtcagatgatgcccctcagttgggaggcggaaaacctacgcgagcag
atcgccgatgagatcaggctgtggtggcacaccgatgagttaaatcaatctaagcccacc
gtcattgatgaagccgactacaccctgcattattttgatgaggtgctctacgatgcgatc
ccagacctgtatgaacgggtcgagaaagccctaactgaaacttttcctcacctcaatcca
cctaaatataatttctgcaagtttggctcttgggtgggctccgatcgggacggcaatcct
tcggtcaagcctgatattacctggcgtaccgcttgctatcaaaggggattagtaattgag
aaatatattagctccgtcaatggattggtgcgtttgttatcggtgtcgcaaaatctgata
gatatttctaccgatttgctaacctcgctggggcaggatcaaacccatatgcccgaagta
tataaccagtttgcggtgcgctatcgccaagagccctatcgcctgaaactgcaatatatt
ctcaagcggctcagaaatacgcgcgatcgcaacgatcgacttaacgaaattggctggcag
gccgccgatcaggtcatgccgatcaagcccaccgatcattctgtttatagcggtgccaaa
gattttgagacagaattgcggctggttgccaatagtcttaagggctctggcctccattgc
aaggcactgcaaaccctgatcaggcaggtagaagtatatggcttccatctggctaatctg
gatattcgtcaggaaagccgcaaacatagcggtgcgatcaccgagatcacctccagctta
aaaattctggatacgccctacgatcagctatctgagtctgagaaagtaaattggcttacc
aaagaactgcaaaccctacggccattaattccagcggatctgcattttggtgactttacc
aatgagatcattgaaacttttcggatgttggcgaaactgcaacaggaattttcgatcgag
atttgcaacacctacatcatcagcatgagcgagagtgtgagtgatgtattagaagtgctg
cttctggccaaagaagcgggtttatataatcctgctactggtactggctcggtttcagtg
gtgcccctatttgaaacggtcgaagatttgcaaggagccaaacgaatcatgcaggaattg
ttcgacctgcggctctatcgcaattacctcaaccaccatgagcatcgccaggaagtaatg
ctgggctattctgatagcaacaaggattcgggcttcctgagtagcaattgggaaatttat
aaggctcaattatcattgcaaaaattggccgagcaatatggcatctggctgtgcattttc
catggtcgtggtggatcggttggtcgtggtggtggcccaacctatcaggcaattctggct
caaccggggcgcagcatcaaaggcgcaattaaaatcaccgagcaaggcgaagtgctggcc
tctaaatattctttattggaaattgccctgcataacttagaaaccgttgccacaggcgtg
attcaggccgcactattgcccagtagctctgacaccctgggtagttggctgcaaaccctt
gaagatttggccacccgatcgcggcaggtatatcgggaactgatccacgagaatcctaat
ctggtggactttttccatgaggtaacgccgatcgaagaaatcagccatttacaaatcagc
tctcgtccagcgcggcgatcggctggtaaaaaggatctatccagcctgcgggcgatcccc
tgggtatttagctggacccaaagccgctttttgttgccatcctggtatggggtgggcact
gcgatcgatgagtttttacaacagcatccagagcacctcaccttgatgcagtttttctac
gaaaagtggcctttctttagaaccaccatctccaaggtggaaatgaccctggccaagtca
gacctgcagatcgccagacattatgtgcgcgagttggctccagcggccaaacaagagtta
tatatgcaattgtttgagcagattgccaatgaatattaccgtacctgtaagataatattg
caaataaccgggcatcatcagcttctagatggcgatcctagcctgcaacgctctgtgcag
ttgcgtaacggctcgattgtaccgcttggctttattcaggctgccctaattaaacggttg
cgccagtataattccgatccaatcaatctgcgatcgcgttattctagaactgaactgctg
cgcggcgcactactgaccattaatggtattgccgccggaatgcgaaatacaggctag

DBGET integrated database retrieval system