KEGG   Pseudomonas aeruginosa B136-33: G655_03315Help
Entry
G655_03315        CDS       T02627                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
psg  Pseudomonas aeruginosa B136-33
Brite
Translation factors [BR:psg03012]
 Eukaryotic Type
  Elongation factors
   G655_03315
 Prokaryotic Type
   G655_03315
Mitochondrial biogenesis [BR:psg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    G655_03315
Exosome [BR:psg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   G655_03315
  Exosomal proteins of breast cancer cells
   G655_03315
  Exosomal proteins of colorectal cancer cells
   G655_03315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
702484..703677
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEKARG
ITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIIIGSALMALE
GKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVERGII
KVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgaacggaacaagccgcacgtcaacgtcggcaccatcggtcac
gttgaccatggcaagaccactctgaccgctgcactgaccaaggtctgctccgacacctgg
ggtggttccgctcgtgctttcgatcagatcgacaacgcgccggaagaaaaggcccgcggt
atcaccatcaacacctcgcacgttgaatacgattccgctgttcgtcactacgcgcacgtt
gactgccccggtcacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgtcaggtaggcgttccctacatcgtcgtgttcctgaacaaggccgacatg
gtcgacgacgccgagctgctggaactggtcgagatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacactccgatcatcatcggttccgcgctgatggcgctggaa
ggtaaagatgacaacggcatcggcgtaagcgccgtgcagaagctggtagagaccctggac
tcctacattccggagccggttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggtaccgtggtaaccggtcgtgtagagcgcggcatcatc
aaggtccaggaagaggtggaaatcgtcggcatcaaggcgaccaccaagaccacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaacgttggtatc
ctgctgcgtggcaccaagcgtgaagacgtagagcgtggccaggtactggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacactccgttcttcaagggctaccgtccgcagttctacttccgtaccaccgac
gtgaccggtaactgcgagctgccggaaggcgtagagatggtaatgccgggcgacaacatc
aagatggttgtcaccctgatcgctccgatcgccatggaagatggcctgcgcttcgcgatc
cgcgaaggcggccgtaccgttggtgccggcgtggttgccaagatcatcgaataa

DBGET integrated database retrieval system