KEGG   Pseudomonas aeruginosa B136-33: G655_03700Help
Entry
G655_03700        CDS       T02627                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    G655_03700
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G655_03700
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    G655_03700
Enzymes [BR:psg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     G655_03700
Peptidoglycan biosynthesis and degradation proteins [BR:psg01011]
 Precursor biosynthesis
  Amino acid ligase
   G655_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
785990..787030
Genome map
AA seq 346 aa AA seqDB search
MGQDKLKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERRLLA
SKVKEVPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAY
TGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEEAVREQLGFPLVVKPNSQGSTV
GLSIVHSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFD
YEHKYQAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEV
NTLPGMTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggacaagttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggac
gtctccatcgccagcggcgcgcaggtgatccaggcgttgcgcagcgccggccaccaggtg
ttggcggtggataccgccagcggcctgctcggcgcggaggaagagcgccgcctgctggcg
agcaaggtcaaggaggtcccgccggactccgactcgctggcgatcatccgcagcggcaag
cagagcctgctgagcgccggcgaactggccggggtcgacgtgttcttcctcgccctgcac
ggcggcaccggcgaggacggcaccctacaggcgctgctggatgccggcggtttcgcctat
accggcagcggccacctggccagcgccatggcgatggacaaggacgtggccaagcgcctg
ttcctcgccgccggggtggagaccgccagttggctgatggcgccggcctcggaagaggcg
gtgcgtgagcaactgggcttccccctggtggtcaagccgaacagccagggctccaccgtg
gggctgtccatcgtgcattcccaggccgaattgcagccggccatcgagctggccgggcgc
tatggcgacgaggtgatgctggagcgcttcgtcgccggccgcgaggttaccgtcggggtg
ctcgacgaccaggcgctgccggtgggcgagattctcctcggtggccaggaagtcttcgac
tacgaacacaagtaccaggccggcgcggtgcgcgaggtgtttcctgccgacctgccgccg
gcgatcgccgccgaggcccagcgtctggcgctgaaggtacatcgggcgctgaagctgagc
ggctacagccgcaccgacttccgcctcgacgaacagggccggctctggtgtctggaggtc
aataccctgccgggaatgaccgccaccagcctgctgccgcaggccgcggcggcggccggg
atcggtttcgccgaactctgcgagcggatctgccggctcggcatcgagcgctgcaagggc
gcgcgcaaggcgcgttcctga

DBGET integrated database retrieval system