KEGG   Pseudomonas aeruginosa B136-33: G655_10700Help
Entry
G655_10700        CDS       T02627                                 

Definition
(GenBank) glutathione S-transferase
Organism
psg  Pseudomonas aeruginosa B136-33
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AGI81063
LinkDB All DBs
Position
complement(2305565..2306227)
Genome map
AA seq 220 aa AA seqDB search
MSLTLYGAPLSPFVRKVRLLLAEKGLDYQLEAIAPFGQPAWYREISPLGRIPALRDGDLA
LADSSVICQYLEERYPEPPNLQGDAPAGRAAVRWLEKYADYEIAPLATLTIFRNRILKPA
MGQACEENDVRRALEEKLPAHFDYLENHLDGRAFFVGERLTLADLAIASQLVNLRHAGEN
LDEQRWPALAAHFARMLERPAMQALLPGERRTLDKLAAKA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgacactctacggagccccgctgtctccgttcgtccgcaaggtccgcctgctc
ctggccgaaaagggcctcgactaccagttggaagcgatcgccccgttcggccagccggcc
tggtatcgcgagatcagtccgctgggccgcatcccggcgttacgcgacggcgacctggcc
ctcgccgactccagcgtgatctgccagtacctggaagaacgctatcccgaaccgccgaat
ctccagggcgacgcccccgccggccgcgcagcggtgcgctggctggaaaaatacgccgac
tacgagatcgctcccctggccacgctgacgatcttccgcaaccggatactcaagccggcg
atgggccaggcctgcgaggagaacgacgtgcgtcgcgcgctggaggaaaagctgccagcg
cacttcgattacctggaaaaccatctcgacggccgggccttcttcgtcggcgagcgactg
accctcgccgacctggcgatcgccagccagttggtcaacctgcgtcacgccggcgaaaac
ctggacgagcaacgctggccggccctcgccgcgcatttcgcgcggatgctcgaacgcccg
gcgatgcaagcgctgctgccgggggaacgacggaccctcgacaagctcgcagcgaaagcc
tga

DBGET integrated database retrieval system