KEGG   Pseudomonas stutzeri RCH2: Psest_0860Help
Entry
Psest_0860        CDS       T02391                                 

Definition
(GenBank) glycosidase
  KO
K22253  glucan 1,4-alpha-maltotetraohydrolase [EC:3.2.1.60]
Organism
psh  Pseudomonas stutzeri RCH2
Brite
Enzymes [BR:psh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.60  glucan 1,4-alpha-maltotetraohydrolase
     Psest_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1921 CBM_20 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AGA85453
UniProt: L0GFC6
LinkDB All DBs
Structure
PDB: 

Jmol
Position
931605..933251
Genome map
AA seq 548 aa AA seqDB search
MSHILRAAALAAILLPLPALADQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNNWYNIL
RQQASTIAADGFSAIWMPVPWRDFSSWSEGGKSGGGEGYFWHDFNKNGRYGSDTQLRQAA
GALGGAGVKVLYDVVPNHMNRGYPNKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFVGG
DADLNTGHPQVYGMFRDEFANLRSQYGAGGFRFDFVRGFAPERVNSWMTDSADNSFCVGE
LWKGPSEYPSWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKNGLNGNPD
PRWREVAVTFVDNHDTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWSHMYDW
GYGDFIRQLIQVRRTAGVRADSAISFHSGYSGLVATVSGTQQTLVVALNSNLSNPGQVAS
ASFSEAVNASNGQVRVWRSGTGSGGGEPGALVKVNFRCDNGVTQPGDSVYAAGSVGQLGN
WSPASAVRLTDTSGYPTWKGSISLPAGQNVEWKCLIRNEANATLVRQWQGGANNSLTPSE
GATTVGRL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagccacatcctgcgtgccgccgcattggcggcaatcctgctgccgctgccggcgctt
gccgatcaggccggcaagagccccaacgccgtgcgctaccacggcggcgacgaaatcatc
ctccagggcttccactggaatgtcgtccgcgaggcgccaaacaactggtacaacatcctt
cgtcaacaggcctcgaccatcgctgccgatggcttctcggcgatctggatgccggtgccc
tggcgtgacttttccagctggagcgaaggcggcaagtccggcggcggcgaaggttacttc
tggcacgacttcaacaagaacggccgctacggcagcgatacccagttgcgccaggccgcc
ggcgcgctcggcggtgccggggtgaaggtgctttacgacgtggtgcccaaccacatgaat
cgcggctacccgaacaaggaaatcaacctgccggccggtcagggtttctggcgcaatgac
tgcgccgacccgggcaactaccccaacgactgcgacgacggcgatcgcttcgtcggcggc
gatgcggacctcaacaccggccatccgcaggtctacggcatgttccgcgacgaattcgcc
aacctgcgcagtcagtatggcgccggcggctttcgcttcgattttgtgcgcggcttcgca
ccggagcgggtcaacagctggatgaccgacagtgccgacaacagtttttgcgtcggcgag
ctgtggaaaggcccctccgaatacccgagctgggattggcgcaataccgccagctggcag
cagatcatcaaggactggtccgatcgggccaagtgcccggtgttcgacttcgcgctcaag
gagcgcatgcagaatggctcgatcgccgactggaagaacggcctgaacggcaaccccgac
ccgcgctggcgcgaggtggcggtgacctttgtcgacaaccacgacaccggctactcgccc
gggcagaacggcggtcagcatcactgggcgctgcaggacgggctgatccgccaggcctac
gcctacatcctcaccagccccggcacgccggtggtgtactggtcgcacatgtacgactgg
ggctacggcgacttcatccgccagctgatccaggtgcgtcgcaccgccggtgtgcgtgcc
gattcggcgatcagcttccacagcggctacagcggtctggttgccaccgtcagcggcacc
cagcagaccctggtggtcgcgctcaattccaatctgagcaatcccggccaggtcgccagc
gccagcttcagcgaggcggtcaacgccagcaacggccaggtacgcgtctggcgcagcggt
acgggcagcggcggcggcgagcccggtgcgctggtcaaggtgaatttccgctgcgacaac
ggcgtgacgcaacccggcgacagcgtctacgcggcgggcagtgtcggtcagctcggcaac
tggagcccggcatccgccgtgcgcctgaccgacaccagcggctacccgacctggaagggc
agcatctccctgccggccggccagaacgtggagtggaaatgcctgatccgcaatgaggcc
aatgcaacgctggtgcggcaatggcagggcggggcgaacaacagcctgacgcccagtgag
ggcgccaccacggttggccggctctag

DBGET integrated database retrieval system