KEGG   Pseudomonas stutzeri RCH2: Psest_2023Help
Entry
Psest_2023        CDS       T02391                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, monomeric type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00020  Citrate cycle (TCA cycle)
psh00480  Glutathione metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01200  Carbon metabolism
psh01210  2-Oxocarboxylic acid metabolism
psh01230  Biosynthesis of amino acids
Module
psh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psest_2023
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psest_2023
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Psest_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH HTH_15
Motif
Other DBs
NCBI-ProteinID: AGA86557
UniProt: L0GLA1
LinkDB All DBs
Position
complement(2141897..2144125)
Genome map
AA seq 742 aa AA seqDB search
MSTPSKIIYTFTDEAPALATYSLLPIVEAFAASAEIAVETRDISLAGRILASFADQLDAD
KKVDDDLAKLAELTNQPDANIIKLPNISASVPQLKAAIAELQALGYNIPNFPEDPQTDAE
KDARARYSKVLGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSKASQSHADYMRGG
DFFSSEQSITMEKAGDVRIEFVGKDGKVEVKKQLALQEGEVLDGMFMSCNKLRAFFEETL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKYGELFKELGVNPNNGISSV
YDKIKSLPVSQQEEILHDIHEVYAHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPVTMGSVPNVGLMAQKAEEY
GSHDKTFEMQADGTMRVVLADGTVLMQHEVEKGDIWRACQTKDAPIRDWVKLAVTRARQS
NTPAIFWLDPERAHDRQLQEKVETYLKDHDLSGLDIRIMGYNEAIRVSMERMIRGQDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNVKAKILGKTLDQATGKLLDNNKSPARKVGQLDNRGSH
FYLALYWAQALAAQDEDAELKAHFAPLAKQLTEQEATIVDELAAVQGKPVDIGGYYRSNP
ELTSKVMRPSATFNSALAALNA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccttcgaagatcatctataccttcaccgacgaagctccagccctggccacc
tattcgcttcttccaattgtagaagccttcgccgcctccgctgagatagccgtcgaaaca
cgcgacatctctcttgcagggcgcattcttgcgagttttgccgaccagttggacgctgac
aagaaagtcgacgacgacctcgccaagcttgccgaactgaccaatcagcccgatgccaac
atcatcaagctgccgaacatcagcgcctccgtaccgcagctcaaagcagccatcgccgag
ctgcaagccctcggctacaacattcccaacttcccggaagacccacagaccgacgccgag
aaagacgcacgcgcgcgttacagcaaggtgctcggcagtgccgtgaatccggtcctgcgt
gaggggaactccgaccgtcgcgccccggccgcagtcaaggcctatgcccgcaagcacccg
cactccatgggcaagtggagcaaggcgtcgcagtcccacgccgactacatgcgcggcggc
gatttcttttccagcgaacaatcgatcaccatggaaaaagccggtgacgtgcgcatcgag
ttcgtcggcaaagacggcaaggtggaagtcaagaagcagctcgccctgcaggaaggcgaa
gtgctcgacggcatgttcatgagctgcaacaagctgcgcgcgttcttcgaagaaaccctg
caggactgcaaggaaaccggcgtgatgtggtcgctgcacgtcaaggccaccatgatgaag
atctcgcacccgatcgtcttcggccatgcggtcagcgtttactacaaggacgtgttcgac
aagtacggcgaactgttcaaggagctgggcgtcaatccgaacaacggcatcagcagcgtc
tacgacaagatcaagtcgctgcccgtctcgcagcaggaagaaattctgcacgacatccat
gaggtctacgcccatcgtccggaaatggcgatggtcgattcggtcaagggcatcaccaac
ctgcacatcccgagcgacgtcatcgtcgacgcctcgatgccggcaatgatccgcaactct
ggtcagatgtggggtaaggacggcaagcagaaggacaccaaagcggtaatgccggaaagc
acttacgcccgcatctaccaggaaatgatcaacttctgcaaaaccaatggtgccttcgac
ccggtcaccatgggcagcgtgccgaacgttggcctgatggctcaaaaggctgaggaatac
ggctcgcacgacaagaccttcgaaatgcaggccgacggcaccatgcgcgtcgttctggcc
gacggcaccgttctgatgcagcacgaagtcgagaaaggcgacatctggcgcgcctgccag
accaaggacgccccgatccgcgattgggtcaagctggccgttacccgcgcccgtcagtcg
aacaccccggcgatcttctggctggacccggagcgcgcccacgatcgtcagctgcaggag
aaagtggaaacctatctcaaggatcacgatctgagtggcctggacatccgcatcatgggc
tacaacgaggccattcgcgtcagcatggagcgcatgatccgtgggcaggacaccatttcg
gtgaccggcaacgtgctacgcgactacctgaccgacctgttcccgatcatggaactgggt
acctcggcgaaaatgctttccatcgttccgctgatggctggtggcggcatgtacgaaact
ggagctggtggctccgcaccaaagcacgtgcagcagctggtggaagaaaactacctgcgc
tgggactccctgggtgagttcctcgccttggccgtgtccctggaagaaaccggaatcaag
accggcaacgtcaaggccaagatcctcggcaagactctggaccaggctaccggcaaactg
ttggacaacaacaagtcgccggcgcgcaaggttggtcagctcgacaaccgcggcagccac
ttctacctcgcactgtactgggctcaggccctggcggcgcaggacgaagacgctgaactc
aaagcccacttcgctccgctggccaagcagctgaccgagcaggaagccaccatcgttgac
gaactcgctgccgttcagggcaagccggtcgacatcggcggctactaccgctccaacccc
gagctgaccagcaaggtgatgcgccccagcgccaccttcaactcagctctggcggcgctg
aacgcctga

DBGET integrated database retrieval system