KEGG   Pseudomonas stutzeri RCH2: Psest_3608Help
Entry
Psest_3608        CDS       T02391                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  
elongation factor Tu
Organism
psh  Pseudomonas stutzeri RCH2
Brite
Translation factors [BR:psh03012]
 Eukaryotic Type
  Elongation factors
   Psest_3608
 Prokaryotic Type
   Psest_3608
Mitochondrial biogenesis [BR:psh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Psest_3608
Exosome [BR:psh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Psest_3608
  Exosomal proteins of breast cancer cells
   Psest_3608
  Exosomal proteins of colorectal cancer cells
   Psest_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3769951..3771144)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSARVDFDKIDSAPEEKARG
ITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTTAVKKLVETLDTYIPEPVRAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
KIQEEIEIVGLRDTTKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLAKPG
TIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNV
KMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgtcggcaccattggtcac
gtcgaccatggcaagaccactctgacggctgctctgactcgcgtgtgctccgaggtattc
ggttccgctcgtgtcgacttcgacaagatcgatagcgccccggaagagaaggctcgcggt
attaccatcaacaccgctcacgtagagtacgactccaacattcgtcactacgcgcacgtt
gattgcccgggtcacgctgactatgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgctgacggccccatgccgcagactcgcgagcacatc
ctgctgtcccgtcaggtaggtgttccgtacatcgtcgtgttcctgaacaaggccgacatg
gttgacgacgccgagctgctcgagctggtggaaatggaagtgcgtgatctgctcagcacc
tacgatttcccgggcgacgatactccgatcatcatcggctccgcgctgatggctctgaac
ggtcaagacgacaacgagatgggcaccactgccgtcaagaagctggtcgagactctggat
acctacatccctgagccggttcgtgccatcgacaagccgttcctgatgccgatcgaagac
gtgttctccatctccggccgcggtaccgtggttaccggtcgtgtggagcgcggcatcgtc
aagatccaggaagaaatcgagatcgttggtctgcgtgacaccaccaagaccacctgtacc
ggtgtcgagatgttccgcaagctgctcgacgaaggtcgtgcgggtgagaactgcggcgtg
ctgctgcgtggcaccaagcgtgatgacgtcgagcgtggccaggttctggctaagccgggc
accatcaagccgcacaccaagttcgaagctgaagtgtacgttctgtccaaggaagaaggt
ggtcgtcacactccgttcttcaagggctaccgtccgcagttctacttccgtaccactgac
gttaccggttcgtgcgagctgccggaaggcgttgagatggtaatgccgggcgacaacgtg
aaaatggttgttaccctgatcaagccgatcgccatggaagacggcctgcgcttcgcgatt
cgcgaaggtggtcgtaccgttggtgctggcgtggttgccaagatcgtcgagtaa

DBGET integrated database retrieval system