KEGG   Plesiomonas shigelloides: SAMEA2665130_2840Help
Entry
SAMEA2665130_2840 CDS       T04378                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pshi  Plesiomonas shigelloides
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pshi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA2665130_2840 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SAMEA2665130_2840 (ppc)
Enzymes [BR:pshi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SAMEA2665130_2840 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3124892..3127525
Genome map
AA seq 877 aa AA seqDB search
MNAQYAAMRSNVSMLGKLLGETIREAGGESLLERVETIRKLSKSSRAGNEQDRRQLLETL
QNLSNDELLPVARAFSQFLNLANIAEQYHTISRNCEANIFCPDAFDTLFNHLKTEGISED
KIQAAVAQLSIELVLTAHPTEITRRTLIHKHVQINRCLDRLEHDDLSEREQNKMQKRLMQ
LIAQAWYTDEIRKERPTPLDEAKWGYAVVENSLWQGVPEFLREFDSRLKEAFGTGLPIDA
IPIRFSSWMGGDRDGNPFVTADITRKAMLLSRWKAADLFLRDVNDLISELSMTECSPALR
AEVGTEAAEPYRVLLKQLRRRLQNTLDYLDARLKGQHATPDDIIDCNEQLWTPLYACYQS
LKDSGMAIIADGLLLDTLRRIRCFGIHLVRLDIRQESTRHTDAVAEITRYLGLGDYAQWS
EEDKQAFLIKELTSKRPLLPHSWQPSADTAEVIETCRAIAEQPAGALASYVISMARQPSD
VLAVHLLQKEAGCAVHLPVAPLFETLDDLNRADEVVRALLNIGWYRGFIQGRQMVMIGYS
DSAKDAGVMAASWAQYRAQEALIKTCEEAGIELTLFHGRGGTIGRGGAPAHAALLSQPPG
SLKGGLRVTEQGEMIRFKLGLPEVAVNSLSLYTSAILQANLLPPPEPKQNWRDTMDVLSD
ESCRVYRSIVREQPDFVPYFRAATPEGELAKLPLGSRPSKRRPDGGVESLRAIPWIFAWT
QNRLMLPAWLGAGDALQKVIDQGQQGILEEMCRDWPFFSTRIGMLEMVFGKTDLWLTEYY
DQRLVEPALWPLGEQLRRMLKHDIGVVLAIANDDHPMADQPWLKESIGLRNIYTDPLNVL
QAELLHRSRQLTESDPQVEQALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacaatatgccgccatgcgcagcaacgtgagtatgctgggcaagctgttgggg
gagacaatccgcgaggccggaggtgaatccctgctggagcgggtagagactatccgcaaa
ttatccaaatcctctcgtgccggcaatgagcaagaccgccgtcagctgctggagaccttg
caaaatctgtccaacgacgaattactgccggtcgcccgcgcgttcagccagtttctgaat
ctggccaacatcgccgagcagtaccacaccatttcacgtaactgtgaagccaatattttc
tgtcctgatgccttcgataccctgttcaatcatctgaaaaccgaagggatcagcgaagac
aagatccaagctgccgtggctcagctctctatcgaactggtgctgaccgcgcacccgacc
gagatcacccgccgcaccctgatccacaagcatgtgcagatcaaccgctgcttagatcgc
ttagagcacgacgatctttccgagcgtgagcaaaacaaaatgcaaaagcgcttgatgcag
ctgattgcgcaggcgtggtacaccgatgagatccgcaaagagcgcccaaccccgctggac
gaagccaaatggggttacgctgtggtggaaaacagcctgtggcaaggggtaccggaattc
ctgcgtgaattcgatagccgcctgaaagaagcctttggcaccggcttgcccattgacgcc
atcccgatccgctttagttcgtggatgggcggcgaccgagacggtaacccgtttgtcacc
gccgacatcacccgcaaagcgatgctgctcagccgctggaaagccgccgatctgttcttg
cgcgatgtgaatgacctgatttctgagctgtcgatgaccgagtgcagcccagcgctgcgc
gccgaagtgggtaccgaggccgccgagccgtaccgcgtactgctcaagcagctgcgtcgt
cgtctgcaaaacaccttggattatctggatgcgcgcctcaaaggccaacacgcaacccca
gatgacatcatcgattgcaacgaacagctgtggacgccgctgtacgcctgttaccagtca
ctgaaagacagtggcatggccattattgccgacggcctgctgctggataccctgcgccgg
atccgctgctttggcatccatctggtgcgcctcgatattcgccaagagagcacccgccac
accgatgcagtagccgaaattacccgctacttaggtctgggcgactatgcccagtggagc
gaagaggacaaacaagcgttcctgattaaggagctgacctcgaagcgtccactgctgcca
cacagctggcagccaagcgccgacaccgcagaagtgattgagacttgccgcgcgattgcc
gaacaaccggccggtgcgctggcctcctacgtgatctcgatggcgcgtcagccatctgat
gtactggcagtccacctgctgcaaaaagaagccggttgcgccgtacacctgccggtcgcg
ccgctgttcgaaaccctcgacgatctgaaccgtgccgatgaagtggtgcgtgccctgctg
aatatcggctggtatcgcggctttattcaaggccgtcagatggtgatgattggctactct
gactcagccaaagatgctggcgtgatggccgcctcgtgggcgcagtaccgcgcacaagaa
gccttgatcaaaacctgtgaagaggctggtatcgagctgaccttgttccacggccgtggc
ggtaccattggtcgtggcggtgcgccagcccatgccgcgttgctgtcgcagccgccgggc
tcgctcaaaggcggcctgcgcgtgaccgaacaaggcgagatgatccgctttaaactcggt
ctgccggaagtggcggtgaacagcttatcgctgtacaccagtgccattttgcaagccaac
ttgttgccgccgccagagccgaagcaaaactggcgcgacactatggatgtgctgtcagac
gagtcttgccgcgtatatcgcagtatcgtgcgtgaacagcctgacttcgtgccgtacttc
cgcgccgcgacgccggaaggggagctagctaagctgccactgggctcgcgcccatccaag
cgtcgccctgatggtggcgtagaaagtctgcgcgcgatcccgtggatctttgcctggacc
cagaaccgtctgatgctgcccgcttggctgggcgccggcgatgcactgcaaaaagtgatc
gaccaaggccagcaaggcattctggaagagatgtgccgcgattggccattcttctccacc
cgtatcggcatgctggagatggtgttcggtaaaaccgatttgtggctgaccgaatactac
gatcaacgcttggtggagccagcattgtggccgctcggcgagcaactgcgtcgtatgctt
aagcatgacatcggggtggtgctggcgattgccaatgatgaccacccgatggccgatcag
ccgtggctgaaagagtccatcggtctgcgtaacatctataccgatccactgaacgtgttg
caggctgaattgctgcatcgctcgcgtcagctgaccgagtccgatccgcaagtggagcaa
gcgctgatggtgaccattgccggtattgccgccggtatgcgtaacaccggttaa

DBGET integrated database retrieval system