KEGG   Providencia stuartii MRSN 2154: S70_11215Help
Entry
S70_11215         CDS       T02042                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    S70_11215
  Energy metabolism
   00680 Methane metabolism
    S70_11215
Enzymes [BR:psi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     S70_11215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2411442..2414081
Genome map
AA seq 879 aa AA seqDB search
MNQQYSAMRSNVSMLGKLLGDTIKEALGEDILDKVESIRKLSKSSRAGNEVQRQKLLMTL
QNLSNDELLPVARAFNQFLNLTNVAEQYHSISPHGEAASNPVALKKLFSRLKEKNFTDSD
LRQAVNQLSIELVLTAHPTEIARRTLIHKLVEVNTCLSQLDHDDLADYERNNIMRRLRQL
VAQSWHTDEIRKIRPTPIDEAKWGFAVVENSLWEAVPAFLREFNEQLEDSIGAELPVEAN
PIRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLKDIQVLVSELSMTEATPELRA
LAGGDEVDEPYRQIAKNLRSQLFSTLEYLERKVKGEQALPPADLLTDNAQLWDPLYACYQ
SLMACGMSIIANGQLLDTLRRIRSFGLQLVRIDVRQESTRHTEALAELTQYLGLGDYAAW
SEEEKQAFLLSELQSRRPLIPRHWQPSPETAEVFETCRVIAESKNDSIAAYVISMAKVPS
DVLAVKLLLKEAGASVRLPVAPLFETLEDLNNAESVMQKLLSIEWYRELIDDRQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKLCDKEGVTLTLFHGRGGTIGRGGAPAHSALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPQVAISSLALYASAILEANLLPPPEPKQEWKSVMDTLS
DVSCAMYRDYVREQPDFVPYFRAATPELELGKLPLGSRPAKRRPTGGVETLRAIPWIFAW
TQNRLMLPAWLGAGAALKYVIEKEGKQAILDEMWQQWPFFNTRIAMLEMVYAKADLWLAE
YYDHRLVEERLWPLGVKLREQLSEDIKSVLAVSKDEALMADLPWIAESIVLRNVYTDPLN
VLQAELLHRSRQQEHPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcaatattccgcaatgcgcagtaatgtcagtatgctgggtaagctacttggc
gacacaatcaaggaagcattaggtgaggatatcctcgataaagtcgaatcaattcgtaag
ttgtcaaaatcatcgcgtgcaggcaatgaagtacaacgccaaaagctgttgatgacactg
caaaacctatctaatgatgaactattaccggttgcaagagcatttaaccaatttttgaac
ctgacaaacgttgccgaacaatatcatagcatttcgccacatggtgaagcagcgagtaac
cctgtggcacttaaaaagctgtttagtcgtttaaaagagaaaaactttaccgatagtgat
cttcgtcaagcggttaaccaactgtcgatcgaattggtgctaacggcccatcctactgaa
atcgcacgccgcaccttgatccataaattggttgaagtgaatacctgcttatcacaactc
gatcatgatgatctggctgattacgaacgcaacaatatcatgcgtcgtttacgccagttg
gtcgctcagtcgtggcacactgacgaaatccgtaaaatacgtccaacgccaattgatgaa
gccaaatggggttttgccgtagttgaaaactcactttgggaagcggttccggctttccta
cgtgaatttaatgagcaattagaagactcaattggtgctgaactgcccgtcgaagcaaac
ccaattcgttttacttcttggatgggaggagaccgcgacggtaacccgaatgtgactgcg
gaagtgactcgtcatgtattactacttagccgctggaaagccgcagatctctttttaaaa
gatatccaagtgttggtttctgaactgtccatgaccgaagcgacacctgagttacgggcg
ctcgctgggggagatgaggtagatgaaccttaccgacaaattgcaaaaaatttgcgtagc
caactcttttccacattagagtatttagaacgcaaggtaaaaggcgaacaagcactacca
ccagccgatttactgaccgacaatgcccaattgtgggatccactatatgcctgttatcaa
tcgttaatggcctgtggtatgagcattattgcgaatgggcagttactcgatacgttacgt
cgtatacggagttttggcttgcaactcgttcgcattgacgttcgccaagaaagtactcgc
catacagaagcgcttgctgaattaacgcaatatcttgggttaggggattatgcagcttgg
agtgaagaggaaaaacaagcctttttactgtctgaattacaatctcgtcggccgttgatc
cctcgtcattggcaaccaagccctgaaacggcagaagtatttgaaacttgccgcgtgatc
gcagaatcgaaaaatgactccatcgcagcttacgtcatttcgatggcgaaagttccttcc
gatgttctggccgttaaattgctcctcaaagaggcgggggcatccgttcgcctgcctgtc
gcacctctgtttgaaacacttgaagatttgaataatgctgaaagtgttatgcaaaaactc
ttgagcattgagtggtatcgtgagctgattgatgaccgccaaatggtcatgattggctac
tctgattcggcaaaagatgctggggtgatggcggcatcatgggcgcaatatcgtgcacaa
gatgcgctgattaagttgtgcgacaaagaaggggtcactttaaccttgttccatggacgt
ggaggcactattggccgtggtggtgcgcccgctcattcagcactcttgtcacaaccgcca
ggcagcctgaaagggggattacgagtgactgaacaaggtgaaatgatccgctttaagttt
ggtctaccacaagtggcgattagcagccttgcgctgtatgcaagcgcgattttagaagct
aatttactgccgccaccggagccaaaacaagagtggaaatcagtgatggataccctctct
gacgtttcttgtgcgatgtaccgtgattatgttcgtgagcagcctgattttgtaccttac
ttccgcgctgcaacaccagagctagaattaggcaagttgccgttggggtctcgtccggca
aaacgccgtccaacggggggcgttgagacattacgtgcgatcccatggatttttgcatgg
acacaaaatcgcctcatgttgcctgcttggttaggggcgggagcagcgttaaaatatgtg
attgagaaagaaggcaaacaagccatattagatgaaatgtggcaacaatggccgttcttt
aatacccgtatcgccatgctggaaatggtttatgcgaaggctgacttgtggctggctgaa
tattatgatcaccgtttagtggaggagcgcctttggcctctgggtgtgaaattacgtgag
cagctctctgaagatattaagagtgtgctggcggtgtccaaagatgaagccttaatggca
gacttaccttggattgcggagtcaattgttttacgtaatgtttatacggacccgttaaac
gttttacaggccgagctactacaccgttctcgccagcaagagcatccggatcctcgcgtt
gagcaagcgttgatggtgacgattgcaggtgttgcagcggggatgcgtaataccggctag

DBGET integrated database retrieval system