KEGG   Pseudorhodoplanes sinuspersici: CAK95_22200Help
Entry
CAK95_22200       CDS       T04834                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psin00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CAK95_22200
Enzymes [BR:psin01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CAK95_22200
DNA repair and recombination proteins [BR:psin03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CAK95_22200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ARQ01514
UniProt: A0A1W6ZVW3
LinkDB All DBs
Position
4558483..4561182
Genome map
AA seq 899 aa AA seqDB search
MPRGSLRDYHAKRDFKLTAEPKGVVGKRKSTGLRYLIQKHDASRLHYDFRLEWNGTLLSW
AVPKGPSENPDDKRLAVHVEDHPIEYGDFEGTIPEGQYGGGTVMLWDTGTWEPHEDDVDA
SLKKGKLGFTLYGKRLKGNWALVKLRRRSPKDKDNWLLIKEHDEYERKTGKLTVERETSS
VKSGRAMDEIAAGKTVWQSNRGNGRGSSRGSSEVEEIIAGPARTKSASGSKKKSLSQSSE
KPPSKTSSVGKTSIARLPAFIAPQLATLVEAPPSGNNWLHEIKYDGYRAVAAVAGDKVAI
WTRNALNWTDKFRSLVPALLKLPCESALLDGEIAVADAEGRTDFGALQNALSEGAGRMAY
YLFDLLLLDGKDLRQRPLIERKDILRDLLSSSAGKGPLIYSDHVVGHGEETFAQASKLKL
EGLISKEAGAPYRSGRTRSWLKSKCGFEQEFVIIGWRPSTKAGRPFSSLLLAVREGDHYR
YAGRVGSGYSGAGLESLSKQFKALARKTPPVKDVPPDIARRAKFIEPQLVAEIAFRGWTR
DGLVRQASFKGLRSDKPAKEIVKETPMPTRKVAKAAATSAKKAASKSAPKASSARRKAAA
PRKPVRSSASDGAEQIEGVRVTHPDKVLFAAQDVTKRELIDHYLSIADAMLPHIVDRPIS
LVRCPSGSGGSCFYQKHASDGFPGEFKSISIREKSGTDKYLYIEDERGLIAAVQVGVLEL
HLWCCHVDDVEKPDRLIFDFDPDEGLDFIHVREAAKEMRARLKDLGLESFPMVTGGKGVH
VVAPLKPGHSWDEHREFAEALARVMAEEHPDRFVANMSKAKRKGKIFVDYLRNQRGATAI
CPFSTRARPGAYVAMPVSWQKLARLDNAHPVAVGEAAKFLGRSDPWPGYFKLRQPLPRM
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcggcagccttcgcgactatcacgccaagcgggacttcaagctaacggccgag
ccgaagggcgtcgtcggcaaacgcaagtcgaccggtttgcgctacctgatccagaagcat
gacgcatcacgcctgcattacgatttccggctggaatggaacggcacgctgctgagctgg
gcggtgccgaaaggaccgagcgagaatcccgacgacaagcgtcttgcggtgcatgtcgag
gatcatccgatcgaatatggcgatttcgaaggcacgattcccgaaggacaatatggcggc
ggcacggtgatgctgtgggacaccggcacctgggagccgcatgaagacgatgtcgatgcc
tcgctgaagaagggcaagcttggcttcacattgtatggcaaacggctgaagggaaactgg
gcgctggtgaaacttcgccggcgcagccccaaagacaaggacaattggctgctgatcaag
gagcatgacgaatacgagcgcaagaccggcaagctgacggtcgagcgcgagacgtcgagc
gtgaaatccggccgggcaatggatgagatcgccgccggcaagacggtctggcaatcgaac
cggggaaacgggcgcgggtcttcacgtgggtcttcggaagtcgaagagatcattgcggga
ccggcgagaacgaaaagcgccagcggctcaaaaaaaaagtccttaagtcagtcaagcgaa
aagccgccaagcaaaacatcaagcgtaggcaaaacgtcaatcgcaagactgccggccttc
atagcgccgcagctcgcaacactggtcgaggccccgccaagcggaaataactggctgcac
gaaatcaaatatgacggctatcgcgcggtcgcggcggttgccggcgacaaggtcgcgatc
tggacgcgcaacgcgctgaattggaccgacaaattccggtcgctggtcccggccttgctg
aagcttccctgcgagagcgcattgctggacggcgagatcgccgttgctgatgcggagggc
cgtaccgatttcggggcgctgcagaatgcgctgagcgaaggggcgggccgcatggcctat
tatctcttcgatctgttgcttctcgatgggaaggatttgcgccagcgtccgttgatcgag
cgcaaggacatactgcgcgatcttttgtcatcctcggccggcaagggaccgctgatctat
tccgaccacgtggtcggtcatggcgaagaaacctttgcgcaagcgagcaagctcaagctg
gaaggcctgatctcgaaagaggccggtgcgccgtatcgttcgggccgcacgcggagctgg
ctgaaaagcaaatgcggtttcgagcaggaattcgtcatcatcggctggcggccatcgacc
aaggcaggacggccattctcatccttgctgctggcggtgcgcgagggcgatcattatcgg
tatgccgggcgcgtcggcagcggctattcgggggcaggactcgaaagcctgtcgaagcag
ttcaaggcgctggcgcgcaagacgccgccggtgaaggatgtgccgccggacatcgcgcgg
cgcgcgaagttcatcgaaccgcagctcgtcgccgaaatcgcctttcgcggctggacgcgc
gatggcctcgtccggcaggcgtcgttcaagggattgcgcagcgacaagcccgcaaaagag
atcgtgaaggagacgccgatgccgacacgcaaggtggccaaggctgctgcgacatccgca
aagaaggcggcaagcaagtctgcgccgaaagcgagcagcgcgcggcggaaggcggcggcc
ccgcgcaagcctgtccgttcgtccgccagcgacggtgcagagcaaatcgaaggcgtccgc
gtcacccatcccgataaggtgctgttcgcggcccaggacgtcaccaagcgcgagttgatc
gatcattatctgtcgattgccgatgcgatgctgccgcatattgttgaccggccgatcagc
ctcgtgcgctgtccgagtggcagcggcggatcgtgcttctatcagaagcatgcctcggat
ggctttcccggcgagttcaagtcgatcagcattcgcgagaaatcgggcaccgacaaatat
ctctatatcgaggacgagcgcgggctcatcgccgcggtgcaggtgggcgtgctggaactg
catctgtggtgctgccatgtcgacgatgtcgagaagccggaccggctgatcttcgatttc
gatcccgacgaggggctcgacttcatacatgtcagggaagcggcgaaggagatgcgcgcc
cggctgaaggatctcggtcttgaatccttcccgatggtgacgggcgggaagggcgtgcat
gtggtcgcaccgctcaagcccggccatagctgggacgagcatcgcgaattcgccgaagcg
ctggcgcgggtgatggcggaggagcatcccgaccgtttcgtcgccaacatgtcgaaggcc
aagcgcaagggaaagatcttcgtcgattatctgcgcaaccagcgcggcgcgacggcgatc
tgcccgttctcgacgcgggcgcggccaggtgcctatgtcgcgatgccggtgtcgtggcag
aagctggcccggctcgacaatgcgcatccggtggcggtgggcgaggcggcaaagtttttg
ggccgcagcgatccctggccgggctacttcaagctcaggcagccgctgccgaggatgtag

DBGET integrated database retrieval system