Phocoena sinus (vaquita): 116744151 Help Entry 116744151         CDS       T07759                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism psiu  Phocoena sinus (vaquita) Pathway psiu04978   Mineral absorption Brite KEGG Orthology (KO) [BR:psiu00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     116744151  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psiu03019]     116744151    03029 Mitochondrial biogenesis [BR:psiu03029]     116744151 Messenger RNA biogenesis [BR:psiu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      116744151 Mitochondrial biogenesis [BR:psiu03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     116744151 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  116744151 NCBI-ProteinID:  XP_032469405 Ensembl:  ENSPSNG00000018260 LinkDB All DBs Position 19:complement(30238610..30240374) Genome browser AA seq 61 aa AA seqDB search MDPKCSCPTGGSCGCAGSCTCKACRCTSCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaagtgctcctgccccactggcggctcctgcggctgcgctggctcctgcacc tgcaaagcctgcagatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgcgccaagtgtgcccagggctgcgtctgcaaaggggcctcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system