KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_5040Help
Entry
PSPPH_5040        CDS       T00266                                 

Gene name
gabT3
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00250  Alanine, aspartate and glutamate metabolism
psp00280  Valine, leucine and isoleucine degradation
psp00410  beta-Alanine metabolism
psp00640  Propanoate metabolism
psp00650  Butanoate metabolism
psp01100  Metabolic pathways
psp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPPH_5040 (gabT3)
   00650 Butanoate metabolism
    PSPPH_5040 (gabT3)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSPPH_5040 (gabT3)
   00280 Valine, leucine and isoleucine degradation
    PSPPH_5040 (gabT3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPPH_5040 (gabT3)
Enzymes [BR:psp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSPPH_5040 (gabT3)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     PSPPH_5040 (gabT3)
Amino acid related enzymes [BR:psp01007]
 Aminotransferase (transaminase)
  Class III
   PSPPH_5040 (gabT3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAZ37457
UniProt: Q48BX1
LinkDB All DBs
Position
5711647..5712951
Genome map
AA seq 434 aa AA seqDB search
MNSKVDEPPHLLRQRDQFVPRGIVTAHPLVIDRAQGSELWDVDGKRYLDFVGGIGVLNIG
HNHPNVVAAIQAQLTKVTHACFQVASYQPYLDLAKRLSHLIAGQSGIDHKAVLFTSGAEA
VENAVKIARAHTNRPAIISFRGGFHGRTLLGTTLTGMSQPYKQNFGPMAPEVFHTPYPNE
YRGVTSEVALAALHELLATQVAPERVAAILIEPMQGDGGFLTAPVEFMKALRALTEQHGI
VLIVDEIQSGFGRTGKWFGFEHSGIQPDLVTVAKSLAGGMPLSGVVGRAEIMDAPLPGGL
GGTYGGNALSCAAALAVIDTYEQDNLLARGEQLGQHLRAGLLKLKDRYTCIGDVRGTGFM
LAMELVKNDAARSPDADLNQKIIDQARIGGLLVIKCGVYRNVLRFLAPLVTTEQQIDEAL
TILDAALARVLKSS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaaagtcgacgaacccccccatctgctccgccagcgcgatcagttcgtgccg
cgcgggattgtcacggcccacccgctggtcatcgaccgggcacagggttctgaattgtgg
gacgtcgatggcaagcgctatctggatttcgtcggcggtatcggcgtgttgaacatcggc
cacaaccacccgaacgtggtcgcggcgattcaggcgcagctgaccaaagtcacccacgcc
tgctttcaggtggcgtcctatcagccctatctggacctggccaaacgcctgagccatctc
atcgcgggccagagcggcatcgatcacaaggccgtgcttttcacctccggcgccgaagcg
gtcgaaaacgcggtgaaaatcgcccgcgcccacactaatcgcccggcaatcatctcgttc
cgcggcggttttcatggccgtacgctgcttggcaccacgctgaccggcatgagccagccg
tacaaacagaatttcggccctatggcccccgaagtgttccacacgccgtacccgaacgag
tatcgcggcgtgaccagcgaagtcgcgctggcggcgttgcacgagctgttggccactcag
gtcgcaccggagcgtgtggcggcgattctgatcgagccgatgcagggcgatggcggcttc
ctgactgcgccagtggagttcatgaaggccttgcgtgcgctgaccgagcaacacggcatc
gtgctgattgtcgatgaaatccagtccggtttcgggcggaccggcaaatggttcggtttc
gagcattcgggtatccagcctgatctggtgacggttgccaagagcctcgcgggcggcatg
ccgctgtcaggcgtggtcggtcgtgccgagatcatggatgcaccgcttccgggcggtctg
ggtggcacttatggtggtaatgcgctgtcctgcgccgccgcactggcggtgatcgacaca
tacgagcaggacaatctgctcgcgcgtggcgagcagctgggccaacatttgcgtgccggt
ctgctcaagctcaaggaccgttacacctgcatcggcgacgtgcgcggcaccggcttcatg
ctcgccatggaactggtcaagaacgacgccgcacgtagcccggacgctgatctcaatcag
aagatcattgatcaggcacgcattggcggcctgttggtgatcaagtgtggtgtgtaccgc
aacgtgttgcgtttcctcgcaccgctggtcaccacagagcagcagatcgatgaagcactg
accattctcgatgccgccttggcacgagtattgaagtccagctga

DBGET integrated database retrieval system