KEGG   Psychrobacter sp. P2G3: AK823_06800Help
Entry
AK823_06800       CDS       T04386                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00620  Pyruvate metabolism
pspg00680  Methane metabolism
pspg01100  Metabolic pathways
pspg01120  Microbial metabolism in diverse environments
pspg01200  Carbon metabolism
Module
pspg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pspg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK823_06800
  Energy metabolism
   00680 Methane metabolism
    AK823_06800
Enzymes [BR:pspg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AK823_06800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMN49621
LinkDB All DBs
Position
1626673..1629453
Genome map
AA seq 926 aa AA seqDB search
MMIDNNVLRERMSLLGSFLGAAISRQSGEQTVHTIETLRKGFIQQRREPNEAQKQELIDF
IASLDNQTLKNVIRGFSIYFFLANLSEENYLREQRHTLRVQSEQSWEGSFRRTLLECRER
NIEPAQMQELIDQLKFIPVFTAHPTEARRRTTMNILQSLFTHSDALNNLNEDSFAYEQAK
EQTAQTIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFNAIPKVYRNIKRAIIDIYPEL
ADYPLPAFMSFGSWIGGDRDGNPFVTFETTELAVLMHADTVLRHYQVLLKKLRRQLIHSD
TTVTVSAEVYTKIKSYDELDRRVFDYNLDDYGNEPYRRLLSLILTKVNATNRLIQSKGSD
SDAKKDAYADPEELLEDLRIIRQSVNGHDTAHAEGLLLDMIRLVKTCGFHLAALDIRQES
SYHSEVIADIFASASNLPDYQTLSESERQEWLTRLLAKPGTPLIYTDNLTDKTREQLALM
NSVATLRKLVGQETFGSYVISMTNNASQLLEVLLLMRFAGLCRVDDAGQLSADLPVAPLF
ETIEDLKNIDKILPAVLDNPLYRGLLQHSDNTQEIMLGYSDSSKDGGIITSAWQLYSAQQ
TINRIAEEYGIKTRLFHGRGGSVSRGGGSTHNAIAAQPAGTLHGQIKVTEQGEVLYAKYA
NTDTAVFELTMGITGTLKACSTRFVVQPAELPDYEALFARLADAGEQRYRELTDNTEGFY
QFYSQVTPVQEISLLNIGSRPAHRKKGLPSKTTLRAIPWVFGWSLARFTLPAWYGVGSAL
HSVKEDEELMREMNKHWPFFSVFISNIEMAFTKSEMNIAHAYSQLCEDEALREQIMKAVI
DEHDLTYSGLNSLLNQTSLLSNQQNLAASLQWRNAYLDPINYIQIELLKRARQKDVTGVV
DHDELDVEDPLIRSINALAAGLRNTG
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgatgatagataacaacgtattacgtgagcgcatgagcttattgggctcattcttaggg
gctgcgatttctcgccaatctggtgaacagacggtacataccattgaaacactgcgtaaa
ggttttatccaacaacgccgcgagcctaatgaagcacaaaagcaggagcttattgacttc
attgcctctttagataatcaaaccttaaaaaacgtcatacgtggcttttctatctatttt
ttcttagcaaatctaagtgaagaaaattacttacgtgagcaacgtcataccctgcgtgtc
cagtctgaacaaagctgggaagggtcgtttcgtcgtaccctgcttgagtgtcgtgaacgc
aatattgaacctgctcagatgcaagagctgattgatcaactcaaatttattcctgtattt
accgcacaccctactgaagctcgccgccgtacgacgatgaatatcttgcaaagtctattt
actcatagcgatgctttaaataatcttaatgaagacagtttcgcctacgagcaagcgaaa
gaacaaacggcgcaaacgattgatttgttatggtcatctgatgaagtacgtacacgtaag
cctttggtttatgacgagataaataatggactgcattattttaacgccagtttatttaat
gccattccaaaggtttatcgtaatattaaaagagccattatcgatatctatccagagcta
gcagactacccattaccagcatttatgagctttggctcttggatcggtggtgacagagat
ggcaatccattcgtgacttttgagaccacagagcttgccgtactaatgcatgctgatacc
gtgttgcgtcactatcaagtactactcaaaaaactgcgccgccagctcattcatagcgat
accactgtaacagtctcagctgaggtctataccaaaatcaaaagttacgatgagctcgac
agacgagtctttgattataatctcgatgattatggcaatgagccttatcgtagattgctt
tctttaatccttactaaagtcaacgctactaatcgccttattcaaagtaaaggtagtgat
agtgacgctaaaaaagatgcctacgccgacccagaagagctgttagaagacctgcgtatc
attcgtcagagtgtgaatggccatgatactgctcatgcagaaggattattgctcgatatg
attcgtctggtaaaaacctgtggctttcatttagccgcgctcgatatccgtcaagagtct
tcttatcatagtgaagtgattgccgatatttttgccagtgcctctaatttgccagactat
caaaccctgagtgaaagcgagcgccaagagtggctaacccgcttgcttgcaaagcctggt
acaccgctcatctataccgataacttgactgataaaacacgtgaacaattggcattgatg
aactcagtggcgacattacgtaagctggtagggcaagagacttttggcagttatgttatt
tcaatgactaataacgctagtcaattattagaagtactactattaatgcggtttgcaggc
ttgtgcagggttgatgatgcaggtcaactgtctgctgacttaccagttgcgccgttgttt
gagacgatcgaagaccttaaaaatattgacaagatattacctgccgtgttggataatcca
ctctatcgaggactgctccaacactcagataacacccaagaaatcatgctaggctattca
gattcatcaaaagatggcggcatcattacctctgcatggcagctttatagtgcgcagcaa
accatcaaccgtatcgctgaggaatacggtatcaaaacgcgcttgttccatgggcgtggt
gggtcagtgagtcgtggtggcggatcaacacataacgcgatcgcagcgcaaccagcaggt
acactacatggtcagattaaagtaactgaacaaggcgaagtactctatgccaaatacgcc
aataccgataccgctgtattcgagctgaccatgggtattacgggtaccctgaaagcctgc
tctaccagattcgttgtgcagcccgctgagctgccagattatgaagcgctctttgcacgt
ttggcagatgcaggtgagcagcgttatcgtgaactgactgataatactgaagggttctat
cagttctactcacaggtgacccctgtgcaagaaatctctttattaaatattggctcacgt
ccagcgcatcgcaaaaaaggcttgccaagcaaaacgactttacgggccattccttgggta
tttggttggtcattggcgcgttttaccttacctgcttggtatggcgttggcagtgctcta
cacagcgtcaaagaagacgaagaattaatgagggagatgaataagcattggccatttttt
agcgtatttatcagcaatatcgagatggcttttaccaagtctgagatgaatatcgctcat
gcctatagtcagttatgtgaagatgaggctttgcgtgaacagattatgaaagcggtcatc
gatgagcacgatttgacctattcaggtctaaattctttgcttaatcaaacgtctttgtta
tctaatcagcaaaaccttgccgcctcactacagtggcgaaacgcttatttagatccgatt
aactatatacaaatcgagctgttaaaacgtgccagacaaaaagacgttacaggcgtcgtc
gatcatgatgagcttgacgttgaagatccattaatccgtagtatcaatgccttggccgca
ggtctacgcaacacgggttaa

DBGET integrated database retrieval system