KEGG   Pseudohongiella spirulinae: PS2015_1026Help
Entry
PS2015_1026       CDS       T04158                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
pspi  Pseudohongiella spirulinae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:pspi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PS2015_1026
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PS2015_1026
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PS2015_1026
   00430 Taurine and hypotaurine metabolism
    PS2015_1026
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    PS2015_1026
Enzymes [BR:pspi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PS2015_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1101813..1103456)
Genome map
AA seq 547 aa AA seqDB search
MSESKKLASASLESLYRIFTVPEAPDSTLGRIDQSISQNLAGFLQEHIVASERDLSDIEK
DFADPQIPEQPTFVSDQIQFVLDKLVAQSVHISAPSFVGHMASALPYFMLPLSRIMMALN
QNLVKVETSKAFTPMERQVVGMIHHLVYGRDKDFYTQWMHDRAHALGSFCSGGTIANLTA
LWAARNNVLAPTEGFAGLGQEGLVAGMQHYGYKGLAILVSERGHYSLGKAADILGIGRRS
LIAIETDANNKIRTDLLAKKCDELAAANIKVMAIVGIAGASETGSIDPLDQMADIAQERG
IHFHVDSAWGGPTLFSNTYRPLLKGIERADSVTLDAHKQLYVPMGAGICVFKEPSTLSSV
EHHAEYIIRKGSKDLGSHTVEGSRPGMAILVHSGLHIIGRQGYELLIDQGISRARHFADM
IRADKDFELISEPELNILTYRYVPQDIQTALESAPASLRTEVNEQLNLVTKRIQKTQRGL
GRSFVSRTRLNPHHHNRNAVIVFRAVLANPLTTNQILQDMLAEQKEIAATPPIQALLKQV
RNLFCGC
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagtaaaaaactggccagcgccagcctcgagtctttgtaccggattttcact
gtaccggaggcaccggattcaacgctggggcgaatcgatcaatcaatatcacagaatctt
gccggttttctgcaggaacatattgtcgcctcagagcgcgatctttcagatatcgaaaag
gatttcgccgacccacagatcccggaacagccgaccttcgtttctgatcagatccagttt
gtactggataaactggtcgctcaatctgtacacatttcggcaccgagttttgtcggtcat
atggcctcggcgctaccctatttcatgctgccgctctcgcgcatcatgatggctctgaac
cagaacctggtaaaggttgaaacttccaaagcctttacaccgatggagcgccaggtcgtc
ggcatgatccatcatctggtatacggccgggacaaggatttttacacccaatggatgcac
gacagggcccatgcactgggcagcttctgctctggtggtacaatcgccaatctgacggcg
ctgtgggcggcacgcaataacgtattggcgccaactgaaggcttcgctggactggggcag
gaaggcctggtggccggcatgcagcactacggatacaaagggctggccattctggtctca
gaacgcggccactattcgctgggtaaggccgccgatattctgggcataggccgccgttcg
ttgatcgctatcgaaaccgacgccaacaataaaatccgcactgacctgctggccaaaaaa
tgtgatgaactggctgcggccaatatcaaagtaatggccattgtcggcattgccggtgca
tctgaaaccggcagcatagatccgctggaccagatggccgatatcgctcaggagcgcggc
atacactttcacgtcgactcagcctggggcggacccacgctgttctcgaatacctaccgc
cccctgctgaagggcattgaaagagccgattcagtcactctggatgcccataagcagcta
tatgtacccatgggtgccggcatttgtgtattcaaggagcccagcacgctgagtagcgtc
gagcatcatgcggagtacataatacgcaaaggctccaaagatctgggcagccatacagtc
gaaggttcacggccgggcatggcgatcctggtgcactcgggattgcatattatcggacgc
cagggttatgaactgcttattgatcagggcatcagtcgcgccagacattttgccgatatg
attcgggccgacaaggattttgaactgatcagcgagcccgaattgaatattctgacctat
cgttatgtaccgcaggatattcagacggctctggaatcggcaccggccagcctgcgcacc
gaggtcaacgaacagctgaacctggtcaccaaacgcattcagaaaactcagcgcgggctt
ggacgatcattcgtttcacgaacccggcttaatccccatcatcacaacaggaatgcggtc
atcgtcttccgggctgtactggccaacccgctgacgaccaatcagattcttcaggacatg
ctggcggagcaaaaagagatcgcagctaccccgccgatacaggcactgctgaagcaggtt
cgcaacctgttctgcggctgctga

DBGET integrated database retrieval system