KEGG   Paraburkholderia sprentiae: BJG93_13935Help
Entry
BJG93_13935       CDS       T04610                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pspw  Paraburkholderia sprentiae
Brite
Translation factors [BR:pspw03012]
 Eukaryotic Type
  Elongation factors
   BJG93_13935
 Prokaryotic Type
   BJG93_13935
Mitochondrial biogenesis [BR:pspw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BJG93_13935
Exosome [BR:pspw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BJG93_13935
  Exosomal proteins of breast cancer cells
   BJG93_13935
  Exosomal proteins of colorectal cancer cells
   BJG93_13935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3121452..3122642
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTQKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMSLADALDTYIPTPERAIDGSFLMPVEDVFSISGRGTVVTGRVERGVVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
INPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggtaagtttgagcggaccaagccgcacgtgaacgtgggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcagcgatcacgacggttctgacgcagaagttc
ggcggcgaagcgaaggcgtacgaccagatcgacgcagcgccggaagaaaaggcgcgcggc
attaccatcaacaccgcgcacgtcgagtacgagacggctaaccgccactacgcacacgtc
gactgcccgggtcacgctgactatgtgaagaacatgatcacgggcgcggcacagatggac
ggcgcaattctggtgtgctcggctgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgagctgctcgagctggtcgagatggaggttcgcgagcttctgtcgaag
tatgacttcccgggcgacgacacgccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaggtggcgatcatgagcctggccgatgcactggacacg
tacatccccacgccggagcgtgcgattgacggttcgttcctgatgccggtggaagacgtg
ttttcgatctcgggtcgtggcacggtggtgacgggccgcgttgagcgtggcgtggtcaag
gttggcgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctcgaccagggtcaggcaggcgacaacgtgggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggtcaggttctggccaagccgggttcg
atcaacccgcacacgcacttcacggctgaagtgtatgtgctgagcaaggacgaaggcggc
cgtcatacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgaactgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcaacccgatcgcgatggaggaaggcctgcgtttcgcaattcgc
gaaggtggccgtacggtcggcgcgggtgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system