KEGG   Paraburkholderia sprentiae: BJG93_18660Help
Entry
BJG93_18660       CDS       T04610                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pspw  Paraburkholderia sprentiae
Pathway
pspw00440  Phosphonate and phosphinate metabolism
pspw01100  Metabolic pathways
pspw01120  Microbial metabolism in diverse environments
pspw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pspw00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BJG93_18660
Enzymes [BR:pspw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BJG93_18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: APA87511
UniProt: A0A1I9YMH8
LinkDB All DBs
Position
2:complement(506521..508266)
Genome map
AA seq 581 aa AA seqDB search
MNAREPAFVSQSRSARLRQMLVSSELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQNDEHFSIVARVEALIAGWGMDEALR
RAEAYAQAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAKEIHASETLVNVDDSVATVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEALTGDRPKVMLPLAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIRLVVNEQYAQAGELASLACALDPGAPPKQSGDTVISYGDLLFRSYILRDLV
ESEAAFSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKIVLRHVASGREQSSAASAAE
PPHGRWVGLLNVRGAGRERLRAVMRELQTRDDFASLDMPALLNALIEAGESIEVQYVHGH
WRGVNDLDDFRRAGDFAHTQAPFATAVGGGSTTNDAHGGPQ
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaacccgctttcgtttcccagtcccgcagcgcgcgcctgcgccagatg
ctcgtcagcagcgaacttgaattcatgatggaggcgcataacggcctgtctgcgcgcatc
gttcgcgaagccggcttcaaggcgatctggggctcgggcctcgcgatttccgcgcagttc
ggggtgcgcgacaacaacgaggcgagctggacccaagtggtcgatacgctcgaattcatg
gccgacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaatttcaac
aacgtgcgccgcctcgtgcgcaagctcgaacagcgcggcatcgcgggcgtgtgcatcgag
gacaagcagtttccgaagaccaacagcttcatcaacggcgaggcccagccgcttgccgat
atcgacgaattctgcggcaagatcaaggccggcaaggattcgcagaacgacgagcatttc
tcgatcgtcgcgcgcgtcgaggcgctgatcgcgggctggggcatggacgaggcgctgcgc
cgtgccgaagcatacgcgcaggccggcgcggatgcgatcctgattcacagcaagctgtcg
cgccccgacgagattctcgaattcgcgcgcgaatgggccggccgcgcgccgctcgtgatc
gtgccgaccaagtactacagcacgccgaccgaggtgttccgcgaagcgggcatcagcacc
gtgatctgggcgaaccatctgatccgcgcggcgacctcggcgatgcaggcggtcgcgaag
gaaatccatgcgagcgagacgctcgtcaacgtcgatgacagcgtcgcgacggtcaatgaa
atcttccgtttgcaggacgccgacgaatactcggaggcggaagaccgttatctgtcgagc
ggccgtgcggccggctcggcggtcgtgctcgccgcgagccgcggcaaggggctggaggcg
ctcaccggggatcgcccgaaggtgatgctgccgctcgccggcaaaccgctgctgcgctgg
ctcgtcgacgcgttcaagaagcagggcgtcaacgacatcaccgtggttggcggctatcgc
gccgacgcgatcgataccgcgggcatccgcctcgtcgtcaatgagcagtatgcgcaggcc
ggcgagcttgcgtcgctcgcgtgcgcgctcgatccgggcgcgccgcccaaacagagcggc
gacacggtcatttcgtacggcgacctgctgtttcgcagctacatcctgcgcgacctggtg
gaaagcgaggcggcgttcagcgtggtcgtcgattcgtcgctgaccgacgcggaaaacgcc
agcgtgcgtgatttcgcgtggtgctcggccgccgatgaccgcggtctgttcggcaataag
atcgtgctgcggcatgtcgcgagcgggcgggagcagtcgtcggcggcgagcgccgcggaa
ccgccgcatggtcgctgggtgggcctgctgaatgtgcgcggcgcgggccgcgagcgtctg
cgggcggtcatgcgcgagttgcagacgcgcgacgatttcgcgtcgctcgacatgcccgcg
ctgctgaacgcgctgatcgaagcgggcgagtcgatcgaggtgcaatatgtgcacggccac
tggcgcggcgtcaacgatctcgacgatttccgtcgcgcgggcgacttcgcgcacacccag
gcgccgttcgcgacagccgtcggcggcgggtcgacaacgaacgatgcacacggaggcccg
caatga

DBGET integrated database retrieval system