KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443770Help
Entry
102443770         CDS       T02980                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss03030  DNA replication
pss03410  Base excision repair
pss03420  Nucleotide excision repair
pss03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pss00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    102443770 (LIG1)
   03410 Base excision repair
    102443770 (LIG1)
   03420 Nucleotide excision repair
    102443770 (LIG1)
   03430 Mismatch repair
    102443770 (LIG1)
Enzymes [BR:pss01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102443770 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102443770 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102443770 (LIG1)
DNA replication proteins [BR:pss03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102443770 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102443770 (LIG1)
DNA repair and recombination proteins [BR:pss03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102443770 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102443770 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     102443770 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 102443770
NCBI-ProteinID: XP_006133053
Ensembl: ENSPSIG00000011945
UniProt: K7FZW6
LinkDB All DBs
Position
Un
AA seq 954 aa AA seqDB search
MMQRPITSFFQPMKGTKAEKETEKIRLPAEEDSTDQVSEAATVQRNGLSLHVDSPVKSAK
RPLRRFLESDSDEEVVMEEAQAEKEPKQDKSPKKTSNKQEHVQTPQSDLSMDSPSPSSSH
SAGDSPALSDSPAVGNADIPKRRTARKQIPKRKMELTISRENNSHEEPTAKRWREQQGPG
DEAGRGAKKEKDVEMQEVKDQHSEMEMAEDNGTLKEVAVNKGEDRGEGGIQKQPEPPQTT
RAISSFFAPKKAPVEKEGKEDKHAAVEPPSVPTSSTTASSDGNDGRAGSFSKLAVPVDPM
EYNPSKSSYNPFQDACWGHGQRVPYLAVARTFERIEEVSARLKNIETLSNLFRSVIALSP
SDILPCIYLCLNRLGPAYKGLELGIGETILMKAVAQATGRQLDQIKAEAQEKGDLGLVAE
SSRSNQRTMFTPPKLSAAGVFSKLQEIARMTGSASMNKKIDIIKGLFVACRHSEARYITR
SLGGKLRIGLAEQSVLSAIAHAVSLTPPGQAFPPEVLDAGQGKSAEARKAWLEEQTQTLK
QTFCELPNYDIIVPVLLEHGVQSLPQHCKITPGIPLKPMLAQPTKGIGEVLKRFEEAAFT
CEYKYDGERAQIHILENGDVHIYSRNQEDNTSKYPDIISRIPKVKKGNVRSCILDAEAVA
WDAEKRQIQPFQVLTTRKRKDVEAAEIKVQVCLYAFDMLYLNGESLVKEPFSKRRQLLHE
SFVEMEGEFLFATSMDTCSMDEISEFLDQSIKDSCEGLMVKTLDVDATYEIAKRSHKWLK
LKKDYLEGVGDTLDLVVIGAYLGKGKRAGMYGGFLLACYDEETEEYQSICKLGTGFTEES
LEKHYSFLKDHVLEKPRPYYRWDSSIEPNHWLAAVQVWEVKCADLSISPVHKAAIGLVDE
EKGISLRFPRFLRVRDDKKPEEATTSSQVAELYKLQQQIQNQQSVEKTEDEDFY
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcgccccatcacgtcatttttccagcccatgaaagggacaaaggctgaaaag
gagacggagaagatcagactaccagcagaggaggactcaaccgaccaagtatcagaggca
gccacagtgcagagaaatggcctgagcctccatgtggactccccagtgaaatctgccaag
aggcccctgcgccgattcttggagagtgacagtgatgaggaagtggtcatggaggaagct
caagcagagaaggagcccaagcaggacaaaagccccaagaaaaccagcaataagcaggag
catgtgcaaactcctcagtctgatctctccatggatagtccctcgccaagcagcagccac
tcggctggagatagcccagcactttctgactcccctgctgttggcaatgctgacatcccc
aaacgcagaacagctcgcaaacagatccccaaacgcaaaatggagctgacaatcagtaga
gagaacaacagccatgaggagccaactgccaagagatggcgagagcaacaaggtccagga
gatgaggcaggcaggggagcaaagaaagagaaagatgtggaaatgcaagaggtgaaagat
cagcattctgagatggaaatggctgaagataatggcactttgaaagaggtggctgtgaac
aagggagaagacagaggtgaagggggaatccagaagcagcccgaaccaccccagaccacc
agagccatctccagcttctttgcccccaagaaggcgccagtggaaaaggaaggaaaggaa
gataaacatgcagcagtggagccaccatctgtcccaactagctcaacgacagcaagcagt
gatgggaatgatggcagagctggcagtttctccaagctagctgtgccagtggaccccatg
gagtacaatccttcgaagagcagctacaatccattccaggatgcctgctgggggcatggt
cagagggtcccctacctggctgtggctcggacctttgagcggatcgaggaggtttctgcc
cgactgaagaacattgagaccctgagcaacctcttccgctcagtgatcgccctgtcgccg
tccgacatcctgccctgcatctacctctgtcttaaccgcctgggccctgcctacaagggt
ctggagctgggcattggcgagaccatcctcatgaaggctgttgcacaggcaacaggccgc
cagctggatcagatcaaagccgaggcccaggaaaagggggatctgggcttggtagcggag
agcagccgtagcaaccaacgcaccatgttcacgccgcccaagctgagtgctgccggggtc
ttcagcaagctacaggagattgccaggatgacaggaagtgcttcaatgaacaagaagatt
gacatcatcaaagggctgtttgtggcctgccggcactcggaagctcgctacatcactcgg
tccctgggtgggaagcttaggattgggctggcggagcagtcagtgctgtcagccattgcc
catgctgtgtctctcactcccccaggacaagcatttcccccagaggtgctggatgctggc
cagggcaaatctgcagaggcacgcaaagcctggctggaggagcagactcagaccctcaaa
cagactttctgtgagctgcctaactatgacatcatagtgcctgtcctgctggagcatgga
gtgcagagcctgccacagcactgcaagatcaccccagggatcccgctgaaacccatgctg
gcccagcccaccaagggtattggggaggtgctgaagcgatttgaggaggctgccttcacc
tgcgagtacaagtatgatggagagcgagcccagatccacatcctggagaatggagatgtg
cacatctacagccgcaaccaggaggacaatacctccaaatacccggacatcatcagccgc
atccccaaggtgaagaagggcaatgtgcggtcatgtatcctggacgctgaggctgtggcc
tgggatgctgagaagaggcagattcaacccttccaggtccttaccacacggaagcgaaag
gacgtggaagctgctgagatcaaagtacaggtgtgtctgtacgcctttgacatgctgtac
ctcaatggagagtccctggtgaaggagccgttctccaagcgccgtcagctgctgcatgag
tcttttgtggagatggagggggagttcttatttgccacctccatggacacatgcagcatg
gatgagatctctgaatttcttgaccagtccatcaaggactcctgcgagggcctcatggtc
aagacgctggatgtggatgccacttacgagattgccaaaagatcccacaaatggctgaag
ctgaagaaggattacctggaaggtgttggtgacacactggacttggtagtgattggtgcc
tatctgggcaagggcaagcgagcaggcatgtatggtggctttctgctggcgtgctatgac
gaggagactgaggagtaccagagcatctgtaagcttgggactggtttcacagaggagagc
ctggagaaacattacagctttctgaaggaccatgtgctggagaaaccacggccctattac
cgctgggacagcagcattgagcccaaccattggctggcagcagtgcaggtgtgggaagtg
aagtgtgctgacctgtccatctcacctgtgcacaaggcagccataggcctggtggatgag
gagaagggcatctccctgcgctttccccggttcctgcgtgtgcgtgatgacaagaagcct
gaggaagccaccaccagctcccaggtggctgaactctacaaactgcagcagcagattcag
aaccaacagtcagtggagaagactgaggatgaggacttctactag

DBGET integrated database retrieval system