KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445996Help
Entry
102445996         CDS       T02980                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102445996 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 102445996
NCBI-ProteinID: XP_006111129
LinkDB All DBs
Position
Un
AA seq 693 aa AA seqDB search
MADLTPTHISWQRNINTSSHCTDRYAHKEPVMRRGQTFVMALWFNRPRQRGEKIAFVTET
GPSPSEAHHTKAAFNLSEVKASGWSAVQEPSEPDYMNIAICSPANAVIGRYKLTLKIISG
NKVSSRFLGHFILLFNPWCPGDDVYVANEDARQEYVLDENGLIFIGNANHIEARGWYYGQ
FQADIINICLTLLDMSLYYNQNPGTDVSRRGDPKYVGRVISSMINGNDNDNGVLEGSWND
HFAEHENPSRWNGSVVILRKWCQENYKPVQYGQCWVFAGVMCTVLRCLGIPTRLITNFNS
AHDADGNLSIDKYYDSAGRSLNISRDSSWDYHVWNEVWFIRRDLGTSYSGWQVLDSTPQE
QSKGIFQCGPASVRAIKEGDVDLDYDTLFVFTEVNADCNQWIIYKDGTRKKAYCDTERIG
KAISTKAVGSNSRVDVTNNYKYPEGSPEERDVYKKAIAKARGATLTERLSEVPNETIRKP
EISGVFKLVETPVFGKDIHLNLILTNPSTENKPVKVNISASTILYTRRAVAEILQEAVSV
DLGSKEEKRIPLKISYAQYEKSLTDDRKILATALCEVMHSQEVKILVEKTITLETPNIFI
KIPAQVVVNKPVTAEISYANPLPEPVKDCVVFVKLMNQEVKIDVADMAPRERSQIYFDFT
PHRSGEIQLQVDFSCDKFSFVKGFETINVALDQ
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggcagacctaacgccaacacacatcagctggcaacggaacatcaacactagctctcac
tgcactgacagatatgcccacaaagagccggtcatgaggagaggacagaccttcgtgatg
gccttgtggttcaacaggccaaggcagaggggggagaaaatagcatttgtcacagaaaca
gggccatccccttcagaggcccatcacactaaggctgcctttaacctctccgaggtgaag
gccagtggctggagtgcggttcaggaacccagcgagcctgactacatgaacattgcaata
tgcagcccagccaatgcagtaattggacgctacaaactgactctgaagatcatctcgggc
aacaaggtctcctccaggttcctggggcactttatactgctctttaacccttggtgtcca
ggtgatgatgtctacgtagcgaatgaagatgcacgacaggaatacgttctggatgaaaat
ggactgatctttattggaaatgcaaaccatattgaagctagaggatggtactatgggcag
tttcaagctgacattataaatatctgtcttaccctgctggatatgagcctgtactataat
cagaacccaggcactgatgtgtcccgccgaggagaccctaaatacgtgggtcgggtgatc
agttccatgatcaacgggaatgacaatgataatggagtgttggagggaagctggaatgac
catttcgctgagcatgaaaacccatccagatggaatgggagtgtggtgatcctccgcaag
tggtgtcaagagaattacaagcctgtccagtatggccagtgctgggttttcgcaggcgtg
atgtgcacagtcctgagatgtttgggaattccaacacgtttgattacaaacttcaattct
gcccatgatgcggatggaaacctgagtattgataaatactatgacagtgctggacggagc
cttaacatcagcagagactcctcatgggattatcatgtctggaacgaagtttggttcatt
cgaagagatttgggaacatcatacagtggatggcaggttctagattcaactccgcaagag
caaagcaaagggatatttcagtgtggtcctgcttcagtcagagccatcaaagaaggtgat
gtagacttggattatgacactctatttgtgtttacggaggtgaacgccgactgcaaccaa
tggattatctacaaagatggaactaggaaaaaagcgtattgtgacactgagagaattggc
aaagccatcagcactaaagctgtgggcagtaattctcgtgtggacgtgactaacaattat
aaatatccagaaggctcgcctgaggaaagagacgtgtataaaaaggccattgccaaggca
cgtggagcaacgctcacagaaagactctctgaagtacctaatgaaaccattaggaaacct
gagatttcaggggtattcaagctggttgaaacccctgtgtttggcaaagatatccatctg
aacttaattctcactaacccgtccactgaaaataagcctgtaaaggtgaacataagtgca
tcaactatcctgtacacaaggagagcagtggcagagatcttgcaagaagccgtctctgtt
gatcttggttctaaagaagagaaacggattccattaaagatctcttatgcccaatatgaa
aagtcccttactgatgacagaaagatcttagcgactgccttgtgtgaagtcatgcactcg
caagaagtaaagatattggtggagaagaccatcactttagagacgccgaacatcttcatc
aagattcctgcacaggttgtggtgaacaagcctgttactgcagagatctcgtatgccaat
cctctccctgagcctgtgaaggactgtgtggtgttcgtaaaactgatgaatcaagaggtc
aagatagatgtggcagacatggcacccagggagcgatcacagatttactttgacttcaca
ccccacagaagtggtgagatccagctgcaggtggacttctcttgcgacaagttttccttt
gttaaagggtttgaaaccattaacgtggccctggatcagtga

DBGET integrated database retrieval system