KEGG   Providencia stuartii BE2467: BGK56_11685Help
Entry
BGK56_11685       CDS       T04734                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
psta  Providencia stuartii BE2467
Brite
Translation factors [BR:psta03012]
 Eukaryotic Type
  Elongation factors
   BGK56_11685
 Prokaryotic Type
   BGK56_11685
Mitochondrial biogenesis [BR:psta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BGK56_11685
Exosome [BR:psta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BGK56_11685
  Exosomal proteins of breast cancer cells
   BGK56_11685
  Exosomal proteins of colorectal cancer cells
   BGK56_11685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2574233..2575417)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GNPEWEAKIVELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREEIERGQVLAKPGSIK
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMK
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKIIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgttcaaaaccgcacgttaacgttggtacaatcggccac
gttgaccacggtaaaactaccctgacagcagcaatcactactgttctggcaaaaacttac
ggcggtagcgctcgtgcattcgatcaaatcgataacgcaccagaagaaaaagcgcgtggt
atcaccatctctacttctcacgtagagtacgatacaccaactcgccactacgcacacgta
gactgcccaggacacgccgactatgttaaaaacatgatcacgggtgctgctcagatggac
ggtgcaatcctagttgttgcggcaacagatggcccaatgccacaaactcgtgagcacatc
ctgttaggtcgtcaggttggcgttccttacatcatcgtgttcctgaacaaatgtgacatg
gtagacgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcaa
tacgatttcccaggtgatgacactccagttatccgtggttcagcgctgaaagcgttggaa
ggcaacccagagtgggaagcgaaaatcgttgaactagcagaagcactggacagctacatc
ccagagccagagcgtgcaattgacaagccattcctgctgccaatcgaagacgtattctca
atctcaggtcgtggtacagtagtcacaggccgtgttgagcgtggtatcatcaaagttggt
gaagaagttgaaatcgtaggtatcaaagagactgcgaaaaccacttgtactggcgttgaa
atgttccgtaaactgctggacgaaggccgtgcgggtgagaacgtaggtgttctgctgcgt
ggtactaagcgtgaagaaatcgaacgtggtcaagttctggcgaaaccaggttcaatcaag
ccacacacaactttcgaatcagaagtttatattctgagcaaagatgaaggtggtcgtcac
acgccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaacaggt
actatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacgtgaacatgaaa
gtaactctgattcacccaatcgcgatggacgatggtttgcgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcgggtgttgttgcaaaaatcattgcataa

DBGET integrated database retrieval system