KEGG   Plautia stali symbiont: E05_08470Help
Entry
E05_08470         CDS       T03051                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
psts  Plautia stali symbiont
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E05_08470
  Energy metabolism
   00680 Methane metabolism
    E05_08470
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E05_08470
Enzymes [BR:psts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     E05_08470
Membrane trafficking [BR:psts04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    E05_08470
Exosome [BR:psts04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   E05_08470
  Exosomal proteins of melanoma cells
   E05_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(678812..679564)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKTWRLNERHYGALQGLDKAETAAKYGDDQVKQWRRGFA
VTPPELDRNDERFPGHDPRYKSLTDAQLPTTESLALTIDRVIPFWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaactaagctggttctggtgcgccacggcgaaagccagtggaatcaggaaaac
cgcttcaccggatggtacgacgtggatctgtccgacaagggtcgcaccgaagccaaagca
gccggtcagctgctgaaaaaagaaggtttcgtgtttgattttgcctacacctcagtgctg
aagcgtgccatccacactctgtggaacgtgctggatgagctggatcaggcctggctgccg
gtcgagaaaacctggcgtctgaacgagcgtcactacggtgcgctgcagggtctggacaaa
gcggaaaccgccgccaaatacggcgacgatcaggtgaaacagtggcgccgtggctttgcc
gttacgccgccagagctggatcgtaacgacgagcgtttcccgggccacgacccgcgctac
aaatcactgaccgacgcgcagctgccgaccaccgaaagcctggcactgaccatcgatcgt
gttatcccattctggaacgagagcattctgccgcgcatcaagagcggtgagaaagtgatc
gttgccgcgcacggtaactcactgcgcgcgctggtgaaatacctcgataacatgagcgaa
gatgagatcctcgaactgaacatcccaaccggcgtaccgctggtgtatgagttcgacgag
aacttcaagccaatcaaacattactatctgggtgatgccgacgagatcgcggcaaaagcc
gccgccgttgctaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system