KEGG   Pseudomonas stutzeri 28a24: CH92_14210Help
Entry
CH92_14210        CDS       T03390                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pstt  Pseudomonas stutzeri 28a24
Brite
Enzymes [BR:pstt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH92_14210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3064340..3064861
Genome map
AA seq 173 aa AA seqDB search
MKQWIIAALAGCTAMSLQAETLSVPMKAVTAKGVGESVGTVKIESSPYGLVFRPELSGLD
SGAHGFHIHAKGSCDPADKDGETIAAGAAGGHWDPKNAGKHGEPWGEGHMGDLPALMVDG
EGHANQPVLAPRLKSLGDIKGLALMVHKGGDNHSDHPQPLGGGGARVACGLIE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtggatcatcgcggccctggccggctgcacggccatgagcctacaagcagaa
accctcagcgtgccgatgaaggcggtaacagccaaaggtgttggcgagtccgtcggtacc
gtcaagatcgagagcagcccgtacggactggtattccgccccgagctgtccggcctcgat
tccggggcgcatggcttccatattcacgccaagggcagttgtgatccggcagacaaggac
ggcgaaaccattgctgcaggcgctgccggaggccattgggatccgaagaatgcgggcaag
catggcgagccctggggtgaaggccatatgggcgatcttccggcgctgatggtcgatggc
gaaggccatgccaaccaaccggttctggcaccccgcctgaaaagcctcggcgacatcaag
ggcctggcgttgatggttcacaaaggcggtgacaaccattccgaccatccacagccgctc
ggtggcgggggcgcccgggttgcgtgcgggctgatcgaataa

DBGET integrated database retrieval system