KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2161Help
Entry
Psesu_2161        CDS       T01403                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Brite
Enzymes [BR:psu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Psesu_2161
Peptidases [BR:psu01002]
 Metallo Peptidases
  Family M2
   Psesu_2161
Exosome [BR:psu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psesu_2161
CD molecules [BR:psu04090]
 Proteins
  Psesu_2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2370538..2372544
Genome map
AA seq 668 aa AA seqDB search
MNHRPLLLAIAVAAGLLSLSACRKTPSPEQEKPAARAENGETADQFVARINAEFKAAYPE
LTSAQWLSSTYINDDSQLVAAKANERALAQLNAWIEEAKKFEGQPMSDDSRRALNLLKQA
TAMPAPRDPEKLAELTRIAAKMEGAYGAGTYCSGEGAARKCRQLGELEDVLRSSRDYDAQ
LDAWAGWHSIAQPMREDYVRFVELVNEGARELGYADTGAMWRSGYDMEPDAFSAETDRLW
EQVRPLYEQLHCYTRDKLQQTYGVERGVVGEGLLPAHLMGNMWQQDWGNLWDMLQPYKGV
GDLDITAALERQYQQLLSAALHRRDPSPGPRERFEAEREAQLAMAKAMTERAQDFYVSLG
MPRLPESYWEKSQFIKPLDRDVVCHASAWDMNMGGADGKSPDVRTKMCIKPNEEDFTTIY
HELGHIYYDLAYNPQPPLFQNGANDGFHEAIGDTIVLAMTPKYLESIGLVQGQAQSHEAL
INTQMRMALAKVSFLPFGLMIDRWRWGVFDGSITPDRYNQAWWELKARYQGVAPVQPRGE
EFFDPGAKYHVPGNTPYTRYFLAHLLQFQFYKSLCEAAGHTGPLYECSFHGSEAAGEKFR
AMLARGASQPWQATLKELTGSERIDGGAVLEYFAPLQEWLQQQNQGKSCGWQGQSAQAPK
PEAPAKAG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccatcgccccctgctgctggccatcgccgtggccgccggcctgctgtcgctgtcg
gcctgccgcaagacgcccagcccggaacaggaaaagcccgccgcccgggccgagaacggc
gagaccgccgaccagttcgtcgcgcgcatcaacgccgagttcaaggccgcctatccggag
ctcacttccgcgcagtggctgtcctcgacctacatcaacgacgacagccagctggtggcg
gccaaggccaacgagcgcgccctggcccagctcaatgcctggatcgaggaagcgaagaag
ttcgagggccagccgatgtccgacgacagccggcgcgccctcaacctgctcaagcaggcc
accgccatgcccgccccgcgcgacccggagaagctggccgagctgacccggatcgcggcg
aagatggaaggcgcctacggcgccggcacctactgcagcggcgaaggcgcggccaggaag
tgccgccagctgggcgagctggaggacgtgctgcgctccagccgcgactacgacgcccag
ctcgacgcctgggccggctggcactcgatcgcccaaccgatgcgcgaggactacgtccgc
ttcgtcgagctggtcaacgagggcgcccgcgaactgggctacgccgacaccggcgcgatg
tggcgcagcggctacgacatggagccggacgccttctccgccgagaccgaccgcctgtgg
gagcaggtgcgcccgctgtacgagcagctgcactgctacacccgcgacaagctgcagcag
acctacggcgtggaacgcggcgtggtcggcgagggcctgctgccggcgcacctgatgggc
aacatgtggcagcaggactggggcaacctctgggacatgctgcagccgtacaagggcgtg
ggcgacctggacatcaccgccgccctggagcgccagtaccagcagttgctcagcgccgcc
ctgcaccgccgcgaccccagccccggcccgcgcgagcgcttcgaggccgagcgcgaggca
cagctggccatggccaaggcgatgaccgagcgcgcccaggacttctacgtctccctgggc
atgccccggctgccggagagctactgggagaagagccagttcatcaagccgctggaccgc
gacgtggtctgccacgccagcgcctgggacatgaacatgggcggcgctgacggcaagtcg
ccggacgtgcgcaccaagatgtgcatcaagcccaacgaggaagacttcaccaccatctac
cacgagctgggccacatctattacgacctggcctacaacccgcagccgccgctgttccag
aacggcgccaacgacggcttccacgaggccatcggcgacaccatcgtgctggcgatgacg
ccgaagtacctggagtcgatcggcctggtccagggccaggcgcagagccacgaggcgctg
atcaacacccagatgcgcatggccctggccaaggtctcgttcctgccgttcgggctgatg
atcgaccgctggcgctggggcgtgttcgacggctcgatcaccccggaccgctacaaccag
gcctggtgggagctgaaggcgcgctaccagggcgtggccccggtgcagccgcgcggcgag
gagttcttcgacccgggtgccaagtaccacgtgccgggcaataccccgtacacccgctat
ttcctggcgcacctgctgcagttccagttctacaagtcgctgtgcgaggccgccggccac
accggcccgctgtacgaatgcagcttccacggcagcgaggccgccggcgagaagttccgc
gccatgctggcgcgcggcgccagccagccgtggcaggccacgctcaaggagctgaccggc
agcgagcggatcgacggcggcgcggtgctggagtacttcgccccgctgcaggaatggctg
cagcagcagaaccagggcaagtcctgcggctggcagggccagtcggcgcaggcgccgaag
ccggaagccccggccaaggcaggctga

DBGET integrated database retrieval system