KEGG   Pseudarthrobacter sulfonivorans: AU252_04640Help
Entry
AU252_04640       CDS       T04210                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psul  Pseudarthrobacter sulfonivorans
Pathway
psul00020  Citrate cycle (TCA cycle)
psul00480  Glutathione metabolism
psul01100  Metabolic pathways
psul01110  Biosynthesis of secondary metabolites
psul01120  Microbial metabolism in diverse environments
psul01130  Biosynthesis of antibiotics
psul01200  Carbon metabolism
psul01210  2-Oxocarboxylic acid metabolism
psul01230  Biosynthesis of amino acids
Module
psul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psul_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psul00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AU252_04640
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AU252_04640
Enzymes [BR:psul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AU252_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH AbiEi_1
Motif
Other DBs
NCBI-ProteinID: ALV40540
UniProt: A0A0U3QUJ0
LinkDB All DBs
Position
complement(1052421..1054640)
Genome map
AA seq 739 aa AA seqDB search
MSKIIYTHTDEAPMLATYSFLPIIEAFASTAGVEVETRDISLAGRIISVFGYYLTPEQQI
GDALAELGELAKTPDANIIKLPNISASIPQLKAAVAELQGQGYNLPDYPDNPSSDEETAV
RSRYDKIKGSAVNPVLREGNSDRRAPLSVKNYARQNPHSMGAWSADSKTNVAHMTADDFR
ANEKSVVIESDGTIALQLVREDGSVKVLKKAFPVLAGEVIDGTVMRAAALDEFLAAQVVR
AKEEGVLFSAHLKATMMKVSDPIIFGHVVKAYFSELFETYGKQLTAAGLSPNNGLAAILS
GLEELPEDVRAGVKALIQKGLDDGPALAMVDSDKGITSLNVPSDIIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGIYQVVLDDCRAHGAFDPTTMGTVPNVGLMAQAAEEYGS
HDKTFEIQEAGTVQIVDGSGAVLIEHEVAPGDIWRACQTKDAPIRDWVKLAVTRARASKT
PAVFWLDETRAHDTNLIAKVNEYLKDHDTEGLQIEIMSPVKATAFTLERIRKGEDTISVS
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLLKENHLRWD
SLGEFLALAVSFEHLATTTNNARAQVLADTLDKATGTFLLENKSPSRRAGELDNRGSHYF
LARYWAEELAKQTEDAELAASFAAVAKELSSNEDTIVGELAAVQGSAVDVGGYYRPDEAK
ASAVMRPSATLNRVIATLN
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagattatctatacccacaccgacgaagcgccgatgctggctacttattcgttc
ttgccgatcatcgaggcgtttgcttcgaccgcaggtgtggaggtggagacccgtgacatt
tcgctcgcaggccgcatcatctccgtgttcggttactacctcaccccggaacagcagatc
ggcgatgcccttgctgaactgggtgagctggcaaagacgccggacgccaacatcatcaaa
ctgcccaacatcagcgcttccatcccgcagctgaaggccgccgtcgccgagctccagggc
cagggctacaacctgccggattacccggacaacccctcctcggacgaggaaacggccgtc
cgctcccgctacgacaagatcaagggctccgctgtgaacccggtcctgcgcgagggaaac
tcggaccgccgtgcaccgctgtccgtcaagaactacgcccgccagaacccgcactccatg
ggtgcctggtccgcggattccaagaccaacgttgcgcacatgacggctgacgacttccgc
gcgaacgagaagtccgtggtcatcgagtccgacggcaccatcgccctccagctggtccgc
gaagacggctcggtcaaggtcctgaagaaggccttcccggtgctggccggcgaggtcatc
gacggcactgttatgcgcgccgcggcgctggacgagttcctggcagcccaggtagtccgc
gccaaggaagagggcgtcctgttctcagcgcacctgaaggccaccatgatgaaggtctcg
gaccccatcatcttcggccacgtggtgaaggcctacttctccgaactgttcgagacctat
ggcaagcagctcaccgccgccgggctgagccccaacaacggccttgctgccatcctgagc
ggcctcgaggagcttccggaggacgtccgtgcaggcgtgaaggcgctcatccagaagggc
ctcgacgacggcccggccctggccatggtggactctgacaagggcatcaccagcctcaac
gtgccctccgacatcatcgtggacgcttccatgcccgccatgatccgcacctccggccac
atgtggggcccggacggccaggaagccgacaccctggcggtcctcccggacagctcctac
gccggcatctaccaggttgttctggacgactgccgcgcccacggcgcctttgaccccacc
accatgggcaccgtcccgaacgtaggcctgatggcccaggccgccgaggaatacggcagc
cacgacaagacgttcgagatccaggaagccggcaccgtgcagatcgtggacggttccggc
gctgtgctgatcgaacacgaggtcgccccgggtgacatctggcgcgcctgccagaccaag
gatgcccccatccgcgactgggtcaagctggccgtcacccgcgcccgcgcctccaagacg
cccgcagtgttctggctggacgagacccgcgcgcacgacaccaacctcatcgccaaggtc
aacgaatacctcaaggaccacgacaccgagggcctgcagatcgagatcatgtccccggtg
aaggcgactgccttcaccctggagcgcatccgcaagggcgaggacaccatctccgtctcc
ggcaacgtgctccgcgactacctcacggacctgttccccatcctggaactgggcaccagc
gccaagatgctgtcggttgttccgctgatgaacggtggtggcctcttcgagaccggcgcc
ggcggatctgctcccaagcacgtccagcagctgctcaaggaaaaccacctgcgatgggac
agcctgggtgaattcctggctctggccgtcagcttcgagcacctggccaccaccacgaac
aacgcccgcgcgcaggtcctggcagacaccctggacaaggcgacgggaactttcctgctg
gaaaacaagtccccgagccgccgcgcgggcgagctggacaaccgtggcagccactacttc
ctcgcccgctactgggctgaggaactggccaagcagaccgaggacgcggagctggcggca
tcgttcgcggctgtggccaaggagctttcctccaacgaggacaccatcgtcggcgaactt
gccgcggtccagggctcagcggtggacgtcggcggttactaccggccggacgaggccaag
gcctcggccgtgatgcgtccgtccgccacgctgaacagggtcattgcgaccctgaactga

DBGET integrated database retrieval system