KEGG   Pseudomonas sp. VLB120: PVLB_22940Help
Entry
PVLB_22940        CDS       T02897                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
psv  Pseudomonas sp. VLB120
Brite
Translation factors [BR:psv03012]
 Eukaryotic Type
  Elongation factors
   PVLB_22940
 Prokaryotic Type
   PVLB_22940
Mitochondrial biogenesis [BR:psv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PVLB_22940
Exosome [BR:psv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PVLB_22940
  Exosomal proteins of breast cancer cells
   PVLB_22940
  Exosomal proteins of colorectal cancer cells
   PVLB_22940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AGZ37367
UniProt: U5VKK1
LinkDB All DBs
Position
complement(5042572..5043765)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVEFDKIDSAPEEKARG
ITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDAYIPEPVRAVDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRETSTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgatcgttcccttccccacgttaacgtcggcaccatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtctgctccgaagttttc
ggttcggcagtcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgtcgagtacaactcgaacattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggttggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacactccgatcatcatcggttcggctcgtatggcgctggaa
ggcaaagacgacaacgaaatgggcactaccgctgtcaagaagctggtagaaactctggat
gcctacattcctgagccagttcgtgccgttgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtt
cgcgttcaagacccgctggaaatcgttggtctgcgtgaaacttcgaccaccacctgcacc
ggtgtcgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctatgttctgtcgaaggaagaaggc
ggtcgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgtcaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagccaaaatcatcgagtaa

DBGET integrated database retrieval system