KEGG   Paenibacillus swuensis: SY83_05725Help
Entry
SY83_05725        CDS       T04884                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pswu  Paenibacillus swuensis
Pathway
pswu00620  Pyruvate metabolism
pswu00680  Methane metabolism
pswu01100  Metabolic pathways
pswu01120  Microbial metabolism in diverse environments
pswu01200  Carbon metabolism
Module
pswu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pswu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SY83_05725
  Energy metabolism
   00680 Methane metabolism
    SY83_05725
Enzymes [BR:pswu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SY83_05725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 TipAS OTCace
Motif
Other DBs
NCBI-ProteinID: ANE45887
UniProt: A0A172TG80
LinkDB All DBs
Position
complement(1353171..1355960)
Genome map
AA seq 929 aa AA seqDB search
MSEVAVVTSKNQPNNLLRRDVRFLGNILGEVLVHQGGTELLDIVEKIREMSKSLRANYVP
SLFEEFKNTIRGLDSENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERTSGENIQPGSI
ESVIVELKDSNISIEEVQELLEGISLELVMTAHPTEAMRRAVLAIHKRIADDVMLLDNPT
ITYREREQLREKLLNEVITLWQTDELRDRKPTVVDEVRNGMYYFDETLFNALPDVYQELE
RCLDKYYPEHAWHVPTYLRFGSWIGGDRDGNPSVTAKVTWETLKMHRQLVLRKYEEILKH
LMGLLSFSTNLIEISPELAESIRKDREQVETRNIDMWRNEREPYRIKLSFMREKLFNTKV
EGISPEAKYNNADELIQDLKIIDRSLRNHFADYVADTELKKTIRQVELFGFHLVALDVRQ
HSKEHENAMAEILAHMNIVKNYPELTEEAKIELLHELLKDPRPLTSPYAQYTPSTQECLD
VYVTIQAAQKEFGVGCISSYLISMTQGASDLLEVMVFAKEVGLYRKDAEGNVVCTLQSVP
LFETIDDLHEAPAIMDTLFQIPAYKQGVEAMNGQQEIMLGYSDSNKDGGMITANWELRVA
LNEITNTGNAHGVKLKFFHGRGGALGRGGMPLNRSILAQPPHTLGGGIKITEQGEVLSSR
YAMQPIAYRSLEQATSALITAALLAKYPQSNAQEEQWNEIIKEISEVAQKKYQDLIFRDP
DFLTFFKESTPLPEIGELNIGSRPSKRKNSDRFEDLRAIPWVFSWTQSRYLLPAWYAAGT
ALQSYYEGNEEKLKILQQMYAKSSFFRTMIDSLQMALAKADLIIAKEYANMIKDKTTEQR
IFGGIQEEYKVTSELIMLITGQQDILDNVPVIQESIRLRNPYVDPLSYMQVQLITELRAL
REQGEDDPDLLREVLLTINGIAAGLRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtagcagtggtgacaagcaagaatcaacccaataatctgctgcggcgggat
gttcgtttcttgggaaacatactgggagaggtgctggtccatcaaggcggaaccgagctt
ctcgatatcgttgagaaaatcagagagatgagcaagtcgctgcgcgcgaactatgttccc
agcttgtttgaagaattcaagaacacgatccgcggcctggattcagaaaatcggcatcaa
gtgatccgcgcattcgcgatctatttccaattggttaacatcgcggaacagaatcaccgg
attcgccgcaagagagactacgagcgtacatccggcgagaatatccaaccgggatccatc
gaaagtgtcatcgtggagctcaaggacagcaacatctccattgaagaagttcaggaattg
cttgagggcatatccctggagcttgtgatgaccgctcatccaacggaagcaatgcgcaga
gccgtattagccatccataaacggatcgcggacgatgtcatgctgctggacaaccccaca
attacttatagagaacgtgaacaactacgcgagaagctcctgaatgaagtcataacgcta
tggcaaacggatgagctgcgtgaccgtaaaccgaccgtagtggatgaagtgcgtaatgga
atgtactattttgacgagacgttgtttaatgccctaccggatgtgtatcaagagcttgaa
cgctgtctggacaaatattatccggagcacgcttggcatgtgccgacttacttgcgattc
ggctcttggattggcggcgatcgggacggaaacccgtccgtaacggctaaggtcacctgg
gaaacgctgaagatgcacagacaactggtcctgcgcaaatatgaagagattctcaagcat
ctgatgggattgcttagcttcagcaccaacctgattgaaatttcacccgagctggcggaa
tccattcgcaaggaccgcgagcaagtggaaacacggaatattgatatgtggcgcaatgag
cgggagccctaccgaattaagctttcttttatgcgtgagaagctgtttaacacgaaagtt
gaagggatttctcccgaagccaaatataataatgcggacgaacttatacaagatcttaaa
atcatcgatcgcagcttgcgcaatcactttgcggactacgtagcggataccgaattgaag
aaaaccattcggcaggttgaactcttcggattccatctggtcgctctggacgtacgtcaa
cacagcaaagagcacgagaacgcgatggctgagattctggcgcatatgaacatcgttaag
aactacccggaactgacggaagaggctaagattgagttgttgcacgagcttcttaaagac
cctaggccgctgacatcgccttacgcgcaatatactccttcaacccaggaatgtctggat
gtgtacgttacaattcaagccgcacagaaggaattcggggtcggctgtatctcgagctac
ctgatatcgatgacgcaaggggcaagcgatctgcttgaagtgatggtgttcgcgaaagaa
gtaggcctctatcgcaaagatgcggaaggcaacgtcgtatgcactctgcaatccgtgcct
ctgttcgaaacaattgacgacttgcacgaagcgccggcgattatggatacattgttccag
attcctgcgtataaacaaggcgtggaagccatgaacgggcagcaggagattatgctgggc
tattccgacagcaacaaagacggcggtatgatcacggccaactgggagcttcgcgtagcg
ctgaacgagattaccaataccgggaatgcgcacggagtgaagcttaagtttttccacggc
cgcggaggcgctttaggccgcggcggcatgccgctgaaccgcagcattctggctcaaccg
ccgcacacgctgggcggaggcattaagattacggagcaaggtgaagtgctctcctcccgg
tacgcgatgcaaccgatcgcttaccggagtctggagcaagccacatccgcgctgatcaca
gccgcgctattggcgaagtacccgcagagcaacgcccaagaagagcaatggaatgagatc
attaaggagatctcggaggtagcacagaagaagtaccaggatctgattttccgagatccg
gacttcctgaccttcttcaaggaatcgacgccgctgccggaaatcggcgagctgaatatc
ggttcgcgtccgtccaagcggaagaatagcgaccgcttcgaggatttgcgcgcgattcca
tgggtattctcatggacgcaaagccggtatttgttaccggcctggtacgcggccggtacg
gctcttcaaagttattacgagggcaacgaggagaagctgaagattttgcaacaaatgtat
gccaagtcttccttcttccgcaccatgatcgacagcctgcaaatggctctggctaaagca
gacttgatcattgccaaggaatatgccaatatgattaaagacaagacaacggaacagcga
atttttggcgggattcaggaggaatataaggttacgtcggaattgattatgctgattaca
ggtcagcaggacattctggataacgtgcctgtcattcaggaatccattcgccttcgcaat
ccgtacgttgatccgctaagctacatgcaagttcagttaattaccgagctgcgtgcgtta
cgcgaacagggagaagacgatccggacctgctgcgtgaagtgttgttaaccatcaacggc
attgctgcaggactgagaaatacaggttaa

DBGET integrated database retrieval system