KEGG   Providencia stuartii ATCC 33672: DR96_1450Help
Entry
DR96_1450         CDS       T03282                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
psx  Providencia stuartii ATCC 33672
Brite
Translation factors [BR:psx03012]
 Eukaryotic Type
  Elongation factors
   DR96_1450 (tuf)
 Prokaryotic Type
   DR96_1450 (tuf)
Mitochondrial biogenesis [BR:psx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DR96_1450 (tuf)
Exosome [BR:psx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DR96_1450 (tuf)
  Exosomal proteins of breast cancer cells
   DR96_1450 (tuf)
  Exosomal proteins of colorectal cancer cells
   DR96_1450 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1580740..1581924
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GNPEWEAKIVELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREEIERGQVLAKPGSIK
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMK
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKIIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgttcaaaaccgcacgttaacgttggtacaatcggccac
gttgaccacggtaaaactaccctgacagcagcaatcactactgttctggcaaaaacttac
ggcggtagcgctcgtgcattcgatcaaatcgataacgcaccagaagaaaaagcgcgtggt
atcaccatctctacttctcacgtagagtacgatacaccaactcgccactacgcacacgta
gactgcccaggacacgccgactatgttaaaaacatgatcacgggtgctgctcagatggac
ggtgcaatcctagttgttgcggcaacagatggcccaatgccacaaactcgtgagcacatc
ctgttaggtcgtcaggttggcgttccttacatcatcgtgttcctgaacaaatgtgacatg
gtagacgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcaa
tacgatttcccaggtgatgacactccagttatccgtggttcagcgctgaaagcgttggaa
ggcaacccagagtgggaagcgaaaatcgttgaactagcagaagcactggacagctacatc
ccagagccagagcgtgcaattgacaagccattcctgctgccaatcgaagacgtattctca
atctcaggtcgtggtacagtagtcacaggccgtgttgagcgtggtatcatcaaagttggt
gaagaagttgaaatcgtaggtatcaaagagactgcgaaaaccacttgtactggcgttgaa
atgttccgtaaactgctggacgaaggccgtgcgggtgagaacgtaggtgttctgctgcgt
ggtactaagcgtgaagaaatcgaacgtggtcaagttctggcgaaaccaggttcaatcaag
ccacacacaactttcgaatcagaagtttatattctgagcaaagatgaaggtggtcgtcac
acgccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaacaggt
actatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacgtgaacatgaaa
gtaactctgattcacccaatcgcgatggacgatggtttgcgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcgggtgttgttgcaaaaatcattgcataa

DBGET integrated database retrieval system