KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_2327Help
Entry
DABAL43B_2327     CDS       T04748                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00473  D-Alanine metabolism
psyc00550  Peptidoglycan biosynthesis
psyc01100  Metabolic pathways
psyc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psyc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DABAL43B_2327 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DABAL43B_2327 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DABAL43B_2327 (ddl)
Enzymes [BR:psyc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DABAL43B_2327 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:psyc01011]
 Precursor biosynthesis
  Amino acid ligase
   DABAL43B_2327 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD TTL ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: SLJ85512
UniProt: A0A1U6GPT2
LinkDB All DBs
Position
I:complement(2728743..2729906)
Genome map
AA seq 387 aa AA seqDB search
MMTMNNTQKNNDNINQGVDSTEQNARGNIKDNIENNIKGDAQNNAAPIINPEPALAAAAR
AEQDKINNDSQSADVLPAIKESKVKEASEFGKVAVIYGGSGNERSVSLDSGAAVLQALQN
QGVDATHFDPKHQDITELRDYDRVFNVLHGRGGEDGLLQGVLQWFDIPQTGSGILASALG
MDKVRTKQLWQGCGLSTAPFSLLTAETDWQQVVNMLGLPLIIKPVHEGSSIGMTKVNHLD
ELPAAYATAVQCGDVVMAERWITGREFTIVIIDDESYPVIRLEPADITNFYDFEAKYNRN
DTSYYIPCGLSAADEKHLQDLSLAAFRAVDAKGWGRIDAMQDEAGNFWLLEINTVPGMTS
HSLVPMAAKARGMDFDSLCWHILAQTL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccatgaataatacgcaaaaaaataacgataatataaaccaaggcgtcgatagt
actgagcaaaacgctagaggcaatattaaagataatattgaaaacaacattaaaggtgat
gctcaaaataacgctgcccctattattaatccagaacccgcattagccgcagctgcacga
gcagagcaagataaaataaacaacgatagccaaagcgcggatgtattgccagctatcaaa
gaaagcaaggtaaaagaggccagtgaatttggtaaagtcgctgttatctacggcggcagt
ggcaacgagcgcagtgtttctttagatagtggtgctgctgtattgcaagcactacaaaac
caaggtgttgatgccacccattttgatcctaagcatcaagatattaccgaactgcgtgat
tatgatcgtgtgtttaacgtcttacatggtcgcggcggcgaagatggtctgttacaaggc
gtgctgcaatggtttgatattccgcagacaggttcgggtattttagcatcggcactcggt
atggataaagtgcgtaccaagcagctgtggcaaggttgtggtttatcaacggcaccattt
tcgttgcttaccgctgagactgactggcagcaagtcgtcaatatgttaggactaccactt
attatcaaaccggtacacgaaggctcaagtattggtatgactaaggttaatcaccttgat
gagctgccagctgcttatgcgacagcggtacagtgcggcgatgtggtaatggctgagcgt
tggattactggtcgcgaatttaccattgttattattgatgatgaatcatacccagtgatt
cgtttagagcctgctgatattaccaatttttacgattttgaagccaaatacaatcgtaac
gataccagttactatattccctgtggtctaagtgccgccgatgaaaagcatctgcaagat
ttaagcttggcagcgtttcgtgccgtcgatgctaaaggttggggacgtattgatgcgatg
caagacgaagcaggtaacttttggctgcttgagattaataccgtaccaggtatgaccagt
catagtttggttccgatggcggctaaagctcgtggtatggactttgatagcttatgttgg
catattttagcgcaaacattataa

DBGET integrated database retrieval system