KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2556Help
Entry
PSTAB_2556        CDS       T01571                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Brite
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSTAB_2556 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2752574..2753095
Genome map
AA seq 173 aa AA seqDB search
MKQWIIAALAGCTAVAVQAETLNVKVNTVTAQGVGESVGSVKIESSDYGLVFRPELSGLQ
PGAHGFHVHAKGSCEPAEIDGKQTPAGAAGGHWDPKNSGKHGEPWGDGHMGDLPALYVDS
EGKASQPVLAPRLKSLGDIKGLALMVHQGGDNHSDHPQPLGGGGARVACGVIE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtggatcatcgccgcgctggccggctgcactgccgtcgccgttcaggctgaa
acattgaacgtcaaggtgaacaccgtgacggcccagggcgtcggcgaatcggtcggcagc
gtcaagatcgaaagcagtgactacgggctggttttccgtcccgagctatcaggcctgcag
cctggagcccatggctttcacgttcacgccaagggcagttgcgagccggccgagatcgac
ggcaagcagaccccggctggcgctgcgggcggtcactgggacccgaagaacagcggcaag
catggcgaaccctggggtgacggccatatgggcgacctcccggcgctgtacgtcgacagt
gaaggcaaagccagtcagccggtgctggcgccgcgactgaagagcctcggcgatatcaaa
gggctggcgttgatggtccaccagggcggagacaaccattccgaccatccgcaacccctc
ggcggcggcggtgcgcgggtcgcctgcggcgtcatcgagtaa

DBGET integrated database retrieval system