KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2731Help
Entry
PSTAB_2731        CDS       T01571                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTAB_2731
  Energy metabolism
   00680 Methane metabolism
    PSTAB_2731
Enzymes [BR:psz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PSTAB_2731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2925514..2928153)
Genome map
AA seq 879 aa AA seqDB search
MAKIIDARLRDNVHLLGELLGNTIRAQHGDQFFDKIERIRKGAKAARKGSAEGAQLLAET
LDSLDESELLPMTRAFNQFLNLANIAEQYHQVRRRAAGEPAPFEIGVFADLIERLKAAGH
DNEFIARQVSRLEIELVLTAHPTEVSRRTLIQKYDAIAQQLAARDHTDLSDAERASIELS
LQRLIAEVWHTEEIRRNRPTPVEEAKWGFAAIENSLWKAVPNVLRQTDATLHRLTGLHLP
LEAAPIRFASWMGGDRDGNPNVTAMVSREVLLTARWVAADLYLREIEGLITALSMREASD
ELLRQSGDSAEPYRVLLKPLRQRLRATREWARAAIEHGQPAPAEVLQDCAELRRPLELCY
RSLHACGMGVIADGALLDCLRRLAVFGLFLVRLDIRQDAARHAAALAEITDYLGLGDYQQ
WDEQKRLDWLQHELANRRPLLPAHYHPSADTAEVLATCAVIAEAPAASLGSYVISMAHAA
SDVLAVQLLLKEAGLQRPMRVVPLFETLDDLNNAAPTIDRLLSLPGYRQRLHGPQEVMIG
YSDSAKDAGTTAAAWAQYRAQEQLVEVCREHGVELLLFHGRGGTVGRGGGPAHAAILSQP
PGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPGWRETMDRL
AAEGVAAYRGVVREHPLFVDYFRQATPELELGRLPLGSRPAKRREGGVESLRAIPWIFAW
TQTRLMLPAWLGWEQALHGALQRGEGERLAEMRARWPFFSTRIDMLEMVLAKADADIARR
YDERLVQPELLSLGSDLRDRLSQVIEAVLSLTGQSDLLDHSPKTQEAFSLRNTYLDPLHL
MQIELLARSRQRQGPAESPLEQALLVSVAGIAAGLRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcatcgatgcgcgcctgcgcgacaacgtacacctgctcggcgaactgctg
ggcaataccatccgcgcgcagcatggcgatcagttcttcgacaagatcgagcgcatccgc
aagggcgccaaggctgcccgcaagggctcggcagagggcgcacagctgctggccgaaacg
ctcgacagtctcgacgagagcgaactgctgcccatgacccgggcgttcaaccagtttctc
aatctggccaatatcgccgagcagtaccatcaggtgcgccggcgcgccgcaggcgagccg
gcgccgttcgagatcggggtgttcgccgatctcatcgagcgtctcaaggcggccgggcac
gacaacgagttcatcgcgcggcaggtcagccgcctggaaatcgaactggtactgaccgcg
catcccaccgaggtatcgcgccgcacgttgatccagaagtacgacgccatcgcccagcag
ctggcggcacgggatcacaccgatctctccgacgccgagcgggcgagcatcgagttgagc
ctgcagcgcctgatcgccgaggtgtggcacaccgaggagatacgccgcaaccggccgacc
ccggtggaggaggccaaatggggtttcgctgccatcgagaattcgctgtggaaggcggtg
cccaacgtgctgcgccagaccgacgcgaccctgcaccgcctcaccggcctgcacctgcca
ttggaggccgcgccgatccgcttcgcctcctggatggggggcgaccgcgacggcaacccg
aacgtcaccgcgatggtgtcgcgcgaggtgctgctgaccgcccgttgggtggccgccgat
ctctacctgcgcgagatagaagggctgattaccgcgctgtccatgcgcgaggccagtgac
gaactgctgcgccagagcggcgactcggccgagccctatcgcgtcttgctcaagccgctg
cgccagcgcctgcgggcgacacgtgagtgggcccgcgcggccatcgagcacggccagcca
gcgccggcggaagtcctgcaggattgcgccgagctgcgtcgtccgctggagctgtgctac
cgctccctgcacgcttgcggcatgggggtgatcgccgatggcgctctgctcgactgcctg
cgtcgcctggccgtgttcggcctgttcctggtgcggctggacattcgccaggatgcggcc
cgtcatgccgccgcgctggccgagatcaccgattacctcgggctaggcgactatcagcag
tgggatgagcagaagcgcctggactggctacagcacgagctggccaatcggcgcccgctg
ctgccggcgcattaccacccatccgccgataccgccgaagtgctcgccacctgtgcggtg
atcgccgaagcgccagcggcgtcgctgggttcctatgtcatctccatggctcacgcggcc
tccgatgtgctcgccgtgcaactgttgctcaaggaggccggcctgcagcgaccgatgcgc
gtggtgccgctgttcgagaccctcgatgacctgaacaacgcggcaccgaccatcgaccgt
ctgctttccctgccgggctatcgccagcgcctgcatggcccccaggaagtgatgattggc
tactccgattcagcgaaggacgccggtaccacggcggcggcctgggcccagtaccgggcc
caggaacaactggtggaggtctgtcgcgagcacggcgtcgaactgctgctgttccacggc
cgcggcggcaccgtcgggcgcggcggcggtccggcccatgcagcgatcctgtcgcagccg
ccgggctcggtcgccgggcgcttccgcaccaccgagcagggcgagatgatccgcttcaag
ttcggcctgccggatatcgccgagcagaacctcaacctgtacctcgcggcggtgctcgaa
gcgacgctgctgccgccaccgccccctgaacccggctggcgcgagacgatggatcggctt
gccgccgagggtgttgcggcctaccgcggcgtggtgcgcgagcatccgctgttcgtcgac
tacttccggcaggcgacgccggagctggagttggggcgcctgccgctgggcagccggccg
gccaagcgccgcgaaggcggcgtcgagagcctgcgggcgattccctggatcttcgcctgg
acccagactcgcctgatgttgccggcctggctgggctgggagcaggcgctgcacggggcg
ctgcagcgcggggagggcgagcggctggccgagatgcgtgcgcgctggccattcttcagt
acgcgcatcgacatgctggagatggtgctggccaaggctgacgccgacatcgcgcggcgc
tacgacgagcgtctggtgcagcctgagctgctttcgctgggtagcgatttgcgtgaccga
ttgtcgcaggtcatcgaggcggtgttgagcctgaccggccagtcggatctgctcgatcac
agccccaagacccaggaggcattcagtttgcgcaatacctacctggacccgctgcacctg
atgcagatcgagttgctggcgcgttccaggcagcggcaaggcccggcggagagccccctc
gagcaggccctgctggtcagcgtggcgggcatcgcggccggtctgcgcaataccggctga

DBGET integrated database retrieval system