KEGG   Paenibacillus terrae: HPL003_14460Help
Entry
HPL003_14460      CDS       T01668                                 

Definition
(GenBank) alanine racemase 1
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00473  D-Alanine metabolism
pta01100  Metabolic pathways
pta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPL003_14460
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HPL003_14460
Enzymes [BR:pta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPL003_14460
Peptidoglycan biosynthesis and degradation proteins [BR:pta01011]
 Precursor biosynthesis
  Racemase
   HPL003_14460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AET59643
UniProt: G7W259
LinkDB All DBs
Position
3108775..3109971
Genome map
AA seq 398 aa AA seqDB search
MQAQYRSTRAEINLDHLGANYEAFRKALPADKLLLACVKANAYGHGAVEISKELERLGAD
YLSVAFLDEALELRQAGIRLPILVLGYTLPEAVQTAWEHDITLTVFSEEVLEGIRRLDRK
GSERKLKVHIKIDSGMGRLGLLPGEEAVAFVRQTHRLEQVLLEGMYTHFARADEEDKSYT
LLQYNRFQGVSEALREQGITIPIIHTGNSATTIDTPALSPNMVRIGISIYGLYPSDEVNW
QAIELLPVLSLKTAVVYTKTLPPGWGVSYGTRYVTSDEERIGTLPIGYADGYSRMLSGKI
EVLIRGRRVPVLGSICMDQCMVSLQSFAEDAEEIQIGEEVVLIGQQSGETIAADELASKL
GTIHYEVICMIAHRVPRVYTRGKIPVVRVNSLLPTRWD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcacaatacagatcgacccgggccgaaatcaacctggatcaccttggcgccaac
tatgaggcttttcgtaaggcattgccagcggataagctgttgctggcttgtgtcaaggct
aatgcctacggacacggtgccgtggaaatatcaaaggaattggaacgccttggtgcggat
tacttgagcgtcgcttttctggatgaagctctggagcttcggcaggcggggattagactg
cctatccttgtactcggctataccctgcctgaagctgtgcagacggcttgggagcatgat
attacactgactgtgttcagtgaagaagtgttggagggtatccgtagactggaccgcaaa
ggaagcgaacgcaagctgaaggtgcacatcaaaatagacagcggcatgggacgactgggc
ctgctgcctggagaagaggcggttgcctttgtccggcagactcatcggttggagcaagtg
ctgctggaaggcatgtacacccattttgcccgcgcggatgaagaagacaaaagctataca
ctgctacagtataatcggtttcagggcgtatcggaggcgctaagggaacaaggcatcacc
attcccattatacatacgggcaacagcgcgaccaccattgatacccctgcgctttccccc
aatatggtgcggattggcatcagtatatacggcctgtatccatccgatgaggttaactgg
caagccattgagctactgcctgtattgtcattgaagacggcagtggtttataccaagacg
ctccctcccggctggggggttagctatggcacccgttacgtgacctccgacgaagagcga
attggcacactgccgattggctacgcggatggatactcccgcatgctgagtgggaaaatc
gaagtgttgatacgcggccgccgcgtcccggtgctcggcagcatttgcatggaccagtgt
atggtatccttacaatctttcgcagaggatgcggaagaaattcaaatcggcgaagaggtt
gttctcatcggtcagcagtccggcgaaacgattgcggcggatgagctggcatccaagctt
ggtaccatccactatgaggtgatctgcatgatcgcacacagggtgccgcgtgtgtataca
cggggaaaaatccctgtcgttcgagtgaattcgcttcttccaacccgctgggattaa

DBGET integrated database retrieval system