Panthera tigris altaica (Amur tiger): 102967278 Help Entry 102967278         CDS       T02988                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04060   Cytokine-cytokine receptor interaction ptg04061   Viral protein interaction with cytokine and cytokine receptor ptg04062   Chemokine signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04657   IL-17 signaling pathway ptg04668   TNF signaling pathway ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg05135   Yersinia infection ptg05142   Chagas disease ptg05144   Malaria ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05168   Herpes simplex virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05323   Rheumatoid arthritis ptg05417   Lipid and atherosclerosis ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102967278 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102967278 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     102967278 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102967278 (CCL2)    04657 IL-17 signaling pathway     102967278 (CCL2)    04062 Chemokine signaling pathway     102967278 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102967278 (CCL2)    05164 Influenza A     102967278 (CCL2)    05168 Herpes simplex virus 1 infection     102967278 (CCL2)    05163 Human cytomegalovirus infection     102967278 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     102967278 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     102967278 (CCL2)    05142 Chagas disease     102967278 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     102967278 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102967278 (CCL2)    05418 Fluid shear stress and atherosclerosis     102967278 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102967278 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102967278 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102967278 (CCL2) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Chemokines    102967278 (CCL2) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Chemokines    102967278 (CCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102967278 NCBI-ProteinID:  XP_007096128 LinkDB All DBs Position Un AA seq 99 aa AA seqDB search MKVSAALLCLLLTAAAFSLQVLAQPDAINSPVTCCYTLTNKKISMQRLMSYKRVTSSKCP KEAVIFKTILNKEICADPNQKWVKDSMAHLDKKTQTAKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagcgcttctgtgcctgctgctcacagcagctgccttcagcctccag gtgctcgcccagccagatgcaattaattctccagtcacctgttgctatacactcaccaat aagaagatctcgatgcagaggctgatgagctataaaagagtcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaaccag aagtgggtcaaggattccatggcacacctggacaagaaaacccaaactgcaaagccttga

DBGET integrated database retrieval system