KEGG   Pelotomaculum thermopropionicum: PTH_1390Help
Entry
PTH_1390          CDS       T00519                                 

Gene name
DdlA
Definition
(GenBank) D-alanine-D-alanine ligase and related ATP-grasp enzymes
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PTH_1390 (DdlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PTH_1390 (DdlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PTH_1390 (DdlA)
Enzymes [BR:pth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PTH_1390 (DdlA)
Peptidoglycan biosynthesis and degradation proteins [BR:pth01011]
 Precursor biosynthesis
  Amino acid ligase
   PTH_1390 (DdlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1441945..1442901)
Genome map
AA seq 318 aa AA seqDB search
MTLKVGVLMGGRSSEREVSLKTGEAVYNALKVKNYLAVKIDVGLDVVERIKEERIDLAFI
ALHGRYGEDGTIQGLLEMLDIPYTGSGVLASALAMDKAATKKIIQYEGLPTPPFMLVEKK
EALKESLQACSERICREMGLPLVVKAPTQGSTIGMSFVHKEEDMAGALELAYDYDPVALV
EQFIRGTEVTASILGNEEPVALPLIEIVSATGVYDYKAKYTAGMSDHIIPPRIPEKQQNA
IKKLAVSTFKSLGCRGLARVDFIVDKQGNPFILEVNTIPGMTATSLFPDAARAAGIEFPD
LIEKLVELAMENCGIRRR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttaaggtcggtgttttgatgggagggcgctcctcggagagagaggtttctctt
aaaaccggggaggctgtttataacgctctgaaggtgaaaaactaccttgcggtaaaaatc
gacgttgggctagatgtagtagaaagaataaaggaagagagaatagatcttgcctttatt
gccttgcacggcaggtacggtgaggacggcaccattcagggactgcttgaaatgcttgac
attccgtataccggctcgggggtcctggctagcgccctggcaatggataaagcagcaaca
aagaagatcattcaatacgaagggcttcccacgccgccctttatgcttgtagaaaaaaaa
gaagccttgaaagaaagcttgcaggcatgtagtgaaaggatatgccgggaaatggggctt
ccgcttgtggtaaaagctcccacccagggctccaccattggtatgtcttttgtacataaa
gaagaagacatggcaggagctcttgaactggcctatgattatgatccggtagccctggtg
gaacagtttatccggggtaccgaagtcactgcttccatcctgggaaatgaggaaccggta
gctcttcctttgatagagattgtttcggcaaccggggtttatgactataaggccaaatat
acagccggaatgagcgatcacataataccgccgcgtatacccgaaaaacagcaaaatgca
ataaaaaaactcgctgtcagcacttttaaatctctgggctgccgggggctggccagggtt
gattttattgtcgataaacagggcaacccctttattcttgaggtgaatactattcccgga
atgactgcaaccagcctctttcccgacgcggcgcgagcagcgggaattgagttccccgat
ctaatagaaaaactggtagagcttgctatggaaaattgtggtataagacggaggtaa

DBGET integrated database retrieval system