KEGG   Picrophilus torridus: PTO0672Help
Entry
PTO0672           CDS       T00177                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pto  Picrophilus torridus
Pathway
pto03030  DNA replication
pto03410  Base excision repair
pto03420  Nucleotide excision repair
pto03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pto00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PTO0672
   03410 Base excision repair
    PTO0672
   03420 Nucleotide excision repair
    PTO0672
   03430 Mismatch repair
    PTO0672
Enzymes [BR:pto01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PTO0672
    6.5.1.6  DNA ligase (ATP or NAD+)
     PTO0672
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PTO0672
DNA replication proteins [BR:pto03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PTO0672
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PTO0672
DNA repair and recombination proteins [BR:pto03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PTO0672
   NER (nucleotide excision repair)
    Other NER factors
     PTO0672
   MMR (mismatch exicision repair)
    Other MMR factors
     PTO0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AAT43257
UniProt: Q6L195
LinkDB All DBs
Position
690837..692609
Genome map
AA seq 590 aa AA seqDB search
MLYINMDFSDVASYFSRMEETTKRLELTSILAELFKRSGDDLKKLVYLVQGKLMPDYLGI
ELGLSDKLIIKSLSKASGRSEEDINRIFSRLGDLGSTAEEISSSGIQRPLLKESLTVDYV
YNQLIKISGYTGHGSIKTKMDAYIDLLINSGPMEIKYITRIITGKLRLGVADSTILDGLI
EAFSEKKYADDIETAYNFHPDLGYIAENLMMGNINELLNAGPVPLIPFKVMLAERLQSIS
DIRNKMGHNASYEYKYDGLRTQLHFLKGGIKIFSRGLEETTSSFPDIVQNFKSYYSFDSC
IIDGESVPYNPETGELYPFQMVSKRRGRKYELTEKTREVPIVMFIFDILYLNGKSLVNLP
YPERRSILEKNFKENEYFKLAKRIVSDDEHDIMKFFERSIEEGCEGIVAKSNGIDSIYRA
GARGWLWIKFKRDYQSELSDSLDLVVVGAFDGHGRRKGTFGALLLACYNSKDDTFETVCK
LGSGFTDEMLSEMPRLLGDKIVEKKPARVNSSMEPDHWIYPSLVLEIRGAEITVSPVHTC
AMNIIEKGSGLALRFPRLIKPRDDKKPEDATTTNEIIEMYKAQKKVIEKS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgttatatataaatatggatttctcggatgttgcatcatacttctcaaggatggaggaa
acaacaaaacgtttggaattaacatcaatacttgctgagctttttaaaagatcaggtgat
gatttaaaaaagcttgtctaccttgtacagggcaagctaatgccggattacttgggcata
gagcttgggctttcagacaaattgataataaaatcgctttcaaaggcgtcgggcagatca
gaagaggatataaacaggatcttctcgaggcttggcgatcttggctccacagcagaggaa
ataagctcatctggaattcaaaggccacttctaaaggaaagtttaacagtcgattatgtt
tacaaccagcttattaagatctcaggttatacaggtcacggaagcataaagacaaagatg
gatgcatacatagatcttttaataaactcgggacccatggagataaaatacataacaagg
ataataactggaaaattaaggcttggcgttgcagattcaacaatacttgatggcttaata
gaggcattttcagagaaaaaatacgcagatgatatagaaacagcgtataattttcacccg
gatcttggctacattgcagagaacctaatgatgggaaatataaatgaacttttaaatgcc
ggtccggttccattaataccatttaaggtcatgctggcagagaggcttcaatcaatttct
gatataagaaataagatggggcacaatgcatcatatgaatataaatacgatggcctcagg
acacagctgcacttccttaaaggcgggataaagatattttccaggggtcttgaggaaacg
acatcaagctttcctgacattgttcaaaattttaagtcatactattcatttgattcgtgt
ataatagatggtgaatcagtgccatacaatcctgaaacaggtgaattatatccatttcaa
atggtttcaaagcgtcgtgggagaaaatatgaactaacagaaaaaacaagggaggtgcca
attgtcatgtttatattcgatatattatatttaaacggtaaatcccttgttaatctgcca
tatcctgaaaggagatcaatactggagaagaattttaaggaaaacgagtactttaagctt
gcaaaaagaatagtttcagatgatgaacacgatataatgaaattctttgaaagatcaata
gaggagggctgtgagggtatagttgcaaagagtaacggcatagattcaatatacagggca
ggtgccaggggctggttatggataaagtttaagagggactaccagagtgagctttccgac
tccctggatctggttgttgttggtgcattcgacggccatggacgtagaaagggaacattt
ggggctcttttgctggcatgctataacagcaaagatgacacatttgaaacggtatgcaag
cttggctcgggctttacagacgaaatgctatctgaaatgccaaggctccttggggacaaa
atcgttgaaaagaagcctgcaagggtgaactcatcaatggaaccggatcactggatatat
ccgtcacttgttcttgagatacgcggtgctgaaataacagttagccctgttcatacctgt
gcaatgaacatcatagaaaagggctctggccttgcattaaggtttccaaggttaataaag
ccaagggatgataaaaagccagaggatgcaacaacaacaaatgagattatagaaatgtat
aaagcacagaaaaaggttattgagaagagttaa

DBGET integrated database retrieval system