KEGG   Pan troglodytes (chimpanzee): 449634Help
Entry
449634            CDS       T01005                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
FoxO signaling pathway
Peroxisome
Longevity regulating pathway
Longevity regulating pathway - multiple species
Huntington's disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    449634 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    449634 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    449634 (SOD2)
   04213 Longevity regulating pathway - multiple species
    449634 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    449634 (SOD2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     449634 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
6
AA seq 199 aa AA seqDB search
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIA
LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQ
GSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA
IWNVINWENVTERYMACKK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacagcctccccgacctgccctacgactacggcgccctggaacctcacatcaac
gcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaataacctgaac
gtcaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcccagatagct
cttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcattttctggaca
aacctcagccctaacggtggtggagaacccaaaggggagttgctggaagccatcaaacgt
gactttggttcctttgacaagtttaaggagaagctgacggctgcatctgttggtgtccaa
ggctcaggttggggttggcttggtttcaataaggaacggggacacttacaaattgctgct
tgtccaaatcaggatccactgcaaggaacaacaggccttattccactgctggggattgat
gtgtgggagcacgcttactaccttcagtataaaaatgtcaggcctgattatctaaaagct
atttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system